![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa07574s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 6823.98 Da PI: 10.9056 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 48.1 | 1.5e-15 | 13 | 50 | 2 | 39 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
++e k r vtfskRr+g++ KA EL+ L da++a++
Csa07574s010.1 13 KVEGKKPRAVTFSKRRKGLFSKAAELCLLSDAQIAILA 50
6788999****************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.7E-9 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 14.577 | 4 | 49 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.8E-8 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.79E-14 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.1E-14 | 13 | 51 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.8E-8 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.8E-8 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MGGLKRKIDT EKKVEGKKPR AVTFSKRRKG LFSKAAELCL LSDAQIAILA TPVSSNSHNS 60 FY |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 16 | 28 | KKPRAVTFSKRRK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa07574s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010431144.1 | 1e-36 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Refseq | XP_010431147.1 | 1e-36 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Refseq | XP_010431165.1 | 1e-36 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| Swissprot | Q9C633 | 5e-25 | AGL97_ARATH; Agamous-like MADS-box protein AGL97 | ||||
| TrEMBL | A0A178W509 | 1e-22 | A0A178W509_ARATH; AGL97 | ||||
| STRING | XP_010431144.1 | 5e-36 | (Camelina sativa) | ||||
| STRING | XP_010431147.1 | 5e-36 | (Camelina sativa) | ||||
| STRING | XP_010431165.1 | 5e-36 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM454 | 17 | 145 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46408.1 | 2e-27 | AGAMOUS-like 97 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




