![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa07g002200.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 130aa MW: 14693.6 Da PI: 4.5581 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 33.1 | 1.2e-10 | 17 | 66 | 14 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
Re+ArrsR RK++++ L ++v +L++ N + +++++e +k++ ++s++
Csa07g002200.1 17 RESARRSRMRKQKQLGDLINEVTVLKNDNAKIAEQVDEASKKYVDMESKN 66
9******************************************9999998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 5.1E-5 | 12 | 68 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 5.8E-9 | 17 | 66 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.4E-6 | 17 | 63 | No hit | No description |
| SuperFamily | SSF57959 | 1.62E-7 | 17 | 62 | No hit | No description |
| CDD | cd14702 | 1.74E-11 | 17 | 59 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MGSLQRQTSP ESDNDPRESA RRSRMRKQKQ LGDLINEVTV LKNDNAKIAE QVDEASKKYV 60 DMESKNNVLR AQALELTDRL RSLNSVLEMV EEISGQALDI PEIPESMQNP WQMPCPMQPI 120 RSSADMFDC* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 20 | 27 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa07g002200.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF400620 | 1e-123 | AF400620.1 Arabidopsis thaliana transcription factor-like protein bZIP53 mRNA, complete cds. | |||
| GenBank | AL162507 | 1e-123 | AL162507.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T12C14. | |||
| GenBank | AY050923 | 1e-123 | AY050923.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds. | |||
| GenBank | AY091421 | 1e-123 | AY091421.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds. | |||
| GenBank | CP002686 | 1e-123 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019082850.1 | 5e-86 | PREDICTED: LOW QUALITY PROTEIN: bZIP transcription factor 53-like | ||||
| Swissprot | Q9LZP8 | 2e-82 | BZP53_ARATH; bZIP transcription factor 53 | ||||
| TrEMBL | D7LT65 | 3e-82 | D7LT65_ARALL; ATBZIP53 | ||||
| STRING | fgenesh2_kg.5__2740__AT3G62420.1 | 5e-83 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3036 | 27 | 63 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G62420.1 | 7e-85 | basic region/leucine zipper motif 53 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




