![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa07g007900.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 161aa MW: 18346.9 Da PI: 10.0175 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 164.4 | 4.2e-51 | 16 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95
lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp ++e yfFs+++ ky++g+r+nr+t sgyWkatg dk++ +
Csa07g007900.1 16 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CDSERYFFSTKEAKYPNGNRSNRSTGSGYWKATGIDKQIGK- 105
79****************************.99***************44...47899**********************************99. PP
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
k+ +vg+kktLvfykg+ p+g++t+Wv+heyrl
Csa07g007900.1 106 KTLAVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 138
8999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.79E-56 | 11 | 146 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 52.257 | 16 | 160 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.1E-27 | 17 | 138 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MEKRSTTIKN RGVLRLPPGF RFHPTDEELV VQYLRRKVTG LPLPASVIPE TDVCKSDPWD 60 LPGDCDSERY FFSTKEAKYP NGNRSNRSTG SGYWKATGID KQIGKKTLAV GMKKTLVFYK 120 GKPPNGTRTN WVLHEYRLVD SQQESSHVRY SQILESVIYY * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-49 | 14 | 159 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-49 | 14 | 159 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-49 | 14 | 159 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-49 | 14 | 159 | 15 | 163 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swm_B | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swm_C | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swm_D | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swp_A | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swp_B | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swp_C | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 3swp_D | 1e-49 | 14 | 159 | 18 | 166 | NAC domain-containing protein 19 |
| 4dul_A | 1e-49 | 14 | 159 | 15 | 163 | NAC domain-containing protein 19 |
| 4dul_B | 1e-49 | 14 | 159 | 15 | 163 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of the mannan synthase CSLA9. Recognizes and binds to DNA-specific sequence of CSLA9 promoter. {ECO:0000269|PubMed:24243147}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa07g007900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF325080 | 1e-167 | AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds. | |||
| GenBank | AF410299 | 1e-167 | AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. | |||
| GenBank | AY093730 | 1e-167 | AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010413856.1 | 1e-108 | PREDICTED: NAC domain-containing protein 41 isoform X1 | ||||
| Refseq | XP_010413857.1 | 1e-108 | PREDICTED: NAC domain-containing protein 41 isoform X2 | ||||
| Swissprot | O22798 | 7e-98 | NAC41_ARATH; NAC domain-containing protein 41 | ||||
| TrEMBL | A0A178VUZ2 | 2e-98 | A0A178VUZ2_ARATH; NAC041 | ||||
| TrEMBL | R0HQU6 | 8e-98 | R0HQU6_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010413856.1 | 1e-107 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1806 | 27 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33480.2 | 1e-100 | NAC domain containing protein 41 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




