![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa08945s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 87aa MW: 10198.7 Da PI: 10.4065 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 102.3 | 6.8e-32 | 9 | 81 | 55 | 128 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk ++s + +gl+ktLvfykgrap+g+k+dW+mheyrl
Csa08945s010.1 9 QNDWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKIICS-CVRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 81
579*********************************9999.9999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 33.496 | 1 | 87 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.7E-31 | 9 | 85 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.0E-16 | 11 | 81 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
ECRIGSTPQN DWYFFSHKDK KYPTGTRTNR ATVAGFWKAT GRDKIICSCV RRIGLRKTLV 60 FYKGRAPHGQ KSDWIMHEYR LDDTPMT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-28 | 9 | 81 | 70 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-28 | 9 | 81 | 70 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-28 | 9 | 81 | 70 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-28 | 9 | 81 | 70 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 3e-28 | 9 | 81 | 73 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 3e-28 | 9 | 81 | 70 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 3e-28 | 9 | 81 | 70 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269|PubMed:17114348, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:17890373}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa08945s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC017118 | 1e-106 | AC017118.3 Genomic sequence for Arabidopsis thaliana BAC F6N18 from chromosome I, complete sequence. | |||
| GenBank | CP002684 | 1e-106 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | EF101892 | 1e-106 | EF101892.1 Arabidopsis thaliana SND1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006304672.1 | 3e-59 | NAC domain-containing protein 12 | ||||
| Refseq | XP_010478697.1 | 3e-59 | PREDICTED: NAC domain-containing protein 12 | ||||
| Refseq | XP_010497688.1 | 7e-61 | PREDICTED: NAC domain-containing protein 12-like, partial | ||||
| Swissprot | Q9LPI7 | 6e-60 | NAC12_ARATH; NAC domain-containing protein 12 | ||||
| TrEMBL | R0IGT7 | 7e-58 | R0IGT7_9BRAS; Uncharacterized protein | ||||
| STRING | XP_006304672.1 | 1e-58 | (Capsella rubella) | ||||
| STRING | XP_010478697.1 | 1e-58 | (Camelina sativa) | ||||
| STRING | XP_010497688.1 | 3e-60 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3436 | 28 | 62 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G32770.1 | 3e-62 | NAC domain containing protein 12 | ||||




