![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa08g056710.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 148aa MW: 17264.6 Da PI: 9.6372 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 184.7 | 2.2e-57 | 17 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95
lppGfrFhPtdeel+++yL++kv + +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
Csa08g056710.1 17 LPPGFRFHPTDEELITHYLHNKVLDMAFSA-KAIGEVDLNKAEPWELPYKAKMGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIYR- 109
79**************************99.88***************99999*****************************************. PP
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
+++lvg+kktLvfy+grapkg kt+Wvmheyrl
Csa08g056710.1 110 GKSLVGMKKTLVFYRGRAPKGLKTNWVMHEYRL 142
999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 8.37E-61 | 13 | 145 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 54.831 | 17 | 147 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.6E-30 | 18 | 142 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MEAFGGFHKE DDEQMDLPPG FRFHPTDEEL ITHYLHNKVL DMAFSAKAIG EVDLNKAEPW 60 ELPYKAKMGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIYRG KSLVGMKKTL 120 VFYRGRAPKG LKTNWVMHEY RLDGKXF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 2e-53 | 14 | 142 | 14 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 2e-53 | 14 | 142 | 14 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa08g056710.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228027 | 0.0 | AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06. | |||
| GenBank | BT006419 | 0.0 | BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010423179.1 | 1e-106 | PREDICTED: NAC domain-containing protein 79 | ||||
| Swissprot | Q9FLR3 | 1e-101 | NAC79_ARATH; NAC domain-containing protein 79 | ||||
| TrEMBL | R0HBK3 | 1e-100 | R0HBK3_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010423179.1 | 1e-106 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM400 | 28 | 174 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G07680.1 | 1e-103 | NAC domain containing protein 80 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




