![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa09068s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 120aa MW: 13166.9 Da PI: 6.3383 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 114.3 | 7.7e-36 | 2 | 87 | 14 | 99 |
DUF260 14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++
Csa09068s010.1 2 PGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKELDAANA 87
78*******************************************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 22.451 | 1 | 89 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.1E-34 | 2 | 86 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MPGCIFAPYF PPEEPHKFAN VHKIFGASNV TKLLNELLPH QREDAVNSLA YEAEARVRDP 60 VYGCVGAISY LQRQVHRLQK ELDAANADLA HYGLSTSAGG TPGNVVDLVF QPQPLQSQQP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-55 | 1 | 102 | 23 | 123 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-55 | 1 | 102 | 23 | 123 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa09068s010.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB008265 | 1e-168 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
| GenBank | AB164305 | 1e-168 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
| GenBank | AB473837 | 1e-168 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
| GenBank | AF447897 | 1e-168 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
| GenBank | BT025745 | 1e-168 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
| GenBank | CP002688 | 1e-168 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010444183.1 | 3e-84 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_010444184.1 | 3e-84 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 1e-81 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | R0GRT8 | 1e-79 | R0GRT8_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010444183.1 | 1e-83 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 5e-84 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




