![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa09g011190.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 121aa MW: 13449.5 Da PI: 8.3974 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 133.6 | 7.9e-42 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
+CaaCk+lrr+C+kdC++apyfp ++p+kfa++h+++Ga nv+k+l++lp+++r +a++sl++eA++r++dPvyG+vg+i+ lq q++++++ela
Csa09g011190.1 5 RCAACKYLRRRCPKDCIFAPYFPPNDPAKFACIHRIYGAGNVSKMLQQLPDQTRAEAVESLCFEAKCRVDDPVYGCVGIIHLLQTQIQNAQNELA 99
6********************************************************************************************** PP
DUF260 96 llkee 100
++++e
Csa09g011190.1 100 KTQAE 104
*9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.642 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.7E-41 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFAPYFPPND PAKFACIHRI YGAGNVSKML QQLPDQTRAE 60 AVESLCFEAK CRVDDPVYGC VGIIHLLQTQ IQNAQNELAK TQAEVAVAQT KLSQTQNSDF 120 * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 9e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 9e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa09g011190.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB473846 | 1e-148 | AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010425374.1 | 1e-85 | PREDICTED: LOB domain-containing protein 24 | ||||
| Swissprot | P59468 | 4e-83 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | R0FT52 | 4e-80 | R0FT52_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010425374.1 | 4e-85 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 2e-85 | LOB domain-containing protein 24 | ||||




