![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa11092s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 103aa MW: 11987.5 Da PI: 4.9478 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 126.1 | 4.2e-39 | 2 | 103 | 214 | 315 |
GRAS 214 ldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
+desvs+e++rd++L+l+kslsP++v++veqe+++n+++Fl rf+e+l+yy+a+f+s++a pr++++ri+ E+++++r+ivn++ace++er+er
Csa11092s010.1 2 PDESVSVENHRDRLLHLIKSLSPRLVTLVEQESNTNTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 96
799******************************************************************************************** PP
GRAS 309 hetlekW 315
he l+kW
Csa11092s010.1 97 HEVLGKW 103
******* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 23.704 | 1 | 103 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.4E-36 | 2 | 103 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MPDESVSVEN HRDRLLHLIK SLSPRLVTLV EQESNTNTSP FLSRFVETLD YYTAMFESID 60 AARPRDDKQR ISAEQHCVAR DIVNMIACEE SERVERHEVL GKW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5hyz_A | 4e-13 | 14 | 103 | 224 | 314 | GRAS family transcription factor containing protein, expressed |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa11092s010.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF419570 | 1e-127 | AF419570.1 Arabidopsis thaliana AT4g17230/dl4650c mRNA, complete cds. | |||
| GenBank | AK226549 | 1e-127 | AK226549.1 Arabidopsis thaliana mRNA for scarecrow-like 13, clone: RAFL07-11-B03. | |||
| GenBank | AK317210 | 1e-127 | AK317210.1 Arabidopsis thaliana AT4G17230 mRNA, partial cds, clone: RAFL22-01-M20. | |||
| GenBank | BT001076 | 1e-127 | BT001076.1 Arabidopsis thaliana At4g17230/dl4650c mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010440036.1 | 1e-67 | PREDICTED: scarecrow-like protein 13 | ||||
| Refseq | XP_010440037.1 | 1e-67 | PREDICTED: scarecrow-like protein 13 | ||||
| Refseq | XP_010449649.1 | 1e-67 | PREDICTED: scarecrow-like protein 13 | ||||
| Refseq | XP_010449650.1 | 1e-67 | PREDICTED: scarecrow-like protein 13 | ||||
| Swissprot | Q9M0M5 | 3e-68 | SCL13_ARATH; Scarecrow-like protein 13 | ||||
| TrEMBL | B9DGM6 | 4e-68 | B9DGM6_ARATH; AT4G17230 protein (Fragment) | ||||
| STRING | fgenesh2_kg.7__2586__AT4G17230.1 | 1e-67 | (Arabidopsis lyrata) | ||||
| STRING | XP_010440036.1 | 4e-67 | (Camelina sativa) | ||||
| STRING | XP_010449649.1 | 5e-67 | (Camelina sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17230.1 | 2e-69 | SCARECROW-like 13 | ||||




