![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa11g077160.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 137aa MW: 15981.1 Da PI: 9.5955 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 100.7 | 9e-32 | 57 | 115 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk++ fprsYY+Ct++gC+vkk+v+r d+ vv++tY+g H+h+
Csa11g077160.1 57 LDDGYRWRKYGQKAVKNNIFPRSYYKCTHEGCRVKKQVQRLLGDEGVVVTTYQGVHTHP 115
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.3E-33 | 42 | 115 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.4E-29 | 49 | 116 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.816 | 52 | 117 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.7E-37 | 57 | 116 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.3E-25 | 58 | 115 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MEDMYQMFFP CSSSVTKVDN SAHHKINTNE EDKPKSKMKK EREPKFSFQT RSQVDILDDG 60 YRWRKYGQKA VKNNIFPRSY YKCTHEGCRV KKQVQRLLGD EGVVVTTYQG VHTHPVDKPS 120 DNFHHILTQM HISPSF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-26 | 47 | 114 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-26 | 47 | 114 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa11g077160.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC246580 | 1e-99 | KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010442347.1 | 1e-100 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Swissprot | Q9S763 | 3e-60 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
| TrEMBL | A0A087H6A0 | 6e-74 | A0A087H6A0_ARAAL; Uncharacterized protein | ||||
| STRING | XP_010442347.1 | 1e-99 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01970.1 | 1e-62 | WRKY DNA-binding protein 45 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




