![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa11g083480.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 173aa MW: 19936.3 Da PI: 10.1077 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.2 | 1.7e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+ ye++s
Csa11g083480.1 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRSYEFAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 59.2 | 1.8e-20 | 85 | 168 | 11 | 94 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94
e+ + l++e + k+ie L+ +R+l+G++L +s+keLq + +q+eksl +Rs+K +l+ +++++l ke+el++e +L
Csa11g083480.1 85 EQYVQGLKKETVTMVKKIEVLEVHNRKLMGQGLAFCSVKELQDIATQIEKSLYIVRSTKAKLYEDELKKLEAKERELKDERVRL 168
566788999*************999******************************************************99877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.2E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.6 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.27E-30 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.03E-37 | 3 | 73 | No hit | No description |
| Pfam | PF00319 | 1.8E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.085 | 88 | 172 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.1E-19 | 89 | 171 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRSYEFASS 60 DIQKTIKRYV EYKRECFGAE THPIEQYVQG LKKETVTMVK KIEVLEVHNR KLMGQGLAFC 120 SVKELQDIAT QIEKSLYIVR STKAKLYEDE LKKLEAKERE LKDERVRLCG KV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 2e-18 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_B | 2e-18 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_C | 2e-18 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_D | 2e-18 | 1 | 73 | 1 | 73 | MEF2C |
| 6c9l_A | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-18 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa11g083480.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY141221 | 1e-178 | AY141221.1 Arabidopsis thaliana MADS-box protein AGL72 mRNA, complete cds. | |||
| GenBank | DQ447061 | 1e-178 | DQ447061.1 Arabidopsis thaliana clone pENTR221-At5g51860 MADS-box protein (At5g51860) mRNA, complete cds. | |||
| GenBank | DQ653360 | 1e-178 | DQ653360.1 Arabidopsis thaliana clone 0000017130_0000012002 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010442692.1 | 1e-121 | PREDICTED: MADS-box protein AGL72-like | ||||
| Refseq | XP_010442693.1 | 1e-121 | PREDICTED: MADS-box protein AGL72-like | ||||
| Swissprot | Q9FLH5 | 1e-101 | AGL72_ARATH; MADS-box protein AGL72 | ||||
| TrEMBL | R0GNE9 | 1e-106 | R0GNE9_9BRAS; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010442692.1 | 1e-121 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51860.2 | 2e-87 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




