PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa11g102220.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 6911.06 Da PI: 11.4343

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa11g102220.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	65.5	5.5e-21	9	56	1	48
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krie ks rqvtfskRrng++ KA LS+LC+ +av+++s +gkly Csa11g102220.1 9 KRIEKKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYN 56 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	27.109	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.27E-23	1	60	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.1E-29	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-23	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.3E-21	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.0E-23	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MGRRKVEIKR IEKKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVSG SGKLYNSSSG 60 DK*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that prevents vernalization by short periods of cold. Acts as a floral repressor. {ECO:0000269\|PubMed:12724541, ECO:0000269\|PubMed:19139056, ECO:0000269\|PubMed:20551443}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa11g102220.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269\|PubMed:15520273, ECO:0000269\|PubMed:15659097}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU980615	7e-68	EU980615.1 Arabidopsis thaliana ecotype Ita-0 MAF2 (MAF2) gene, complete cds; MAF3 gene, complete sequence; MAF4 (MAF4) gene, complete cds; and MAF5 (MAF5) gene, partial cds.
GenBank	EU980616	7e-68	EU980616.1 Arabidopsis thaliana ecotype Bu-2 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980617	7e-68	EU980617.1 Arabidopsis thaliana ecotype Hau-0 MAF2 (MAF2), MAF3 (MAF3), and MAF4 (MAF4) genes, complete cds.
GenBank	EU980618	7e-68	EU980618.1 Arabidopsis thaliana ecotype Li-3 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980620	7e-68	EU980620.1 Arabidopsis thaliana ecotype PHW-1 MAF2 (MAF2) gene, complete cds; MAF3 gene, complete sequence; and MAF4 (MAF4) and MAF5 (MAF5) genes, complete cds.
GenBank	EU980621	7e-68	EU980621.1 Arabidopsis thaliana ecotype Nd-0 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980622	7e-68	EU980622.1 Arabidopsis thaliana ecotype PHW-33 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980623	7e-68	EU980623.1 Arabidopsis thaliana ecotype Co-1 MAF2 (MAF2) gene, partial cds; and MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980624	7e-68	EU980624.1 Arabidopsis thaliana ecotype Bu-0 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980625	7e-68	EU980625.1 Arabidopsis thaliana ecotype No-0 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980627	7e-68	EU980627.1 Arabidopsis thaliana ecotype Kas-1 MAF2 (MAF2) gene, partial cds; and MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980628	7e-68	EU980628.1 Arabidopsis thaliana ecotype Chi-1 MAF2 (MAF2), MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980629	7e-68	EU980629.1 Arabidopsis thaliana ecotype Gr-3 MAF2 gene, complete sequence; and MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	EU980630	7e-68	EU980630.1 Arabidopsis thaliana ecotype Bs-1 MAF2 gene, complete sequence; and MAF3 (MAF3), MAF4 (MAF4), and MAF5 (MAF5) genes, complete cds.
GenBank	HM487066	7e-68	HM487066.1 Arabidopsis thaliana ecotype Sha MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.
GenBank	HM487067	7e-68	HM487067.1 Arabidopsis thaliana ecotype Tu-1 MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.
GenBank	HM487068	7e-68	HM487068.1 Arabidopsis thaliana ecotype KZ-10 MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.
GenBank	HM487069	7e-68	HM487069.1 Arabidopsis thaliana ecotype Gr-3 MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.
GenBank	HM487070	7e-68	HM487070.1 Arabidopsis thaliana ecotype Sg-1 MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.
GenBank	HM487071	7e-68	HM487071.1 Arabidopsis thaliana ecotype UWO MADS affecting flowering 2 (MAF2) gene, complete sequence, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010462383.1	3e-35	PREDICTED: agamous-like MADS-box protein AGL27 isoform X6
Refseq	XP_019094207.1	3e-35	PREDICTED: agamous-like MADS-box protein AGL31 isoform X5
Refseq	XP_019094208.1	3e-35	PREDICTED: agamous-like MADS-box protein AGL27 isoform X7
Refseq	XP_019094210.1	3e-35	PREDICTED: agamous-like MADS-box protein AGL27 isoform X8
Swissprot	Q9FPN7	8e-33	AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBL	E4MW80	1e-31	E4MW80_EUTHA; mRNA, clone: RTFL01-07-K22
STRING	Bostr.0568s0285.1.p	6e-35	(Boechera stricta)
STRING	XP_010462368.1	4e-34	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G65050.2	1e-26	AGAMOUS-like 31

Publications ? help Back to Top
Suter L,Rüegg M,Zemp N,Hennig L,Widmer A Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis. Plant Physiol., 2014. 166(4): p. 1928-42 [PMID:25339407]