![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa11g102240.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 176aa MW: 20153.2 Da PI: 8.4512 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 61.9 | 7.3e-20 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
krie ks rqvtfskRrng++ KA LS+LC+ +av+++s +gkly
Csa11g102240.2 9 KRIEKKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYN 56
79********************************************97 PP
| |||||||
| 2 | K-box | 38.2 | 6.1e-14 | 99 | 163 | 33 | 98 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
qR+l e +++ s+ L+++e+qLe++l+ R+kK+el+++ ++ lq+ ek l+een+ L +++
Csa11g102240.2 99 IVQRKLE-EPVDNVSVDSLMSMEEQLETALSVTRAKKTELMMDDLKSLQETEKLLREENQFLASQV 163
4455543.88999*************************************************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 27.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.1E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.89E-25 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.04E-31 | 2 | 71 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.9E-20 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 10.595 | 70 | 169 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.3E-10 | 102 | 163 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 176 aa Download sequence Send to blast |
MGRRKVEIKR IEKKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVSG SGKLYNSSSG 60 DNMSKIIDRY EIQHADELKV LDLEEKTRNY LPHKELLDIV QRKLEEPVDN VSVDSLMSME 120 EQLETALSVT RAKKTELMMD DLKSLQETEK LLREENQFLA SQVTKTQTLM LHKTD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 2e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 2e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 2e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 3e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa11g102240.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY231445 | 1e-166 | AY231445.1 Arabidopsis thaliana MADS affecting flowering 3 variant I (MAF3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010444476.1 | 1e-112 | PREDICTED: agamous-like MADS-box protein AGL31 isoform X6 | ||||
| Swissprot | Q9LSR7 | 2e-96 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
| TrEMBL | A0A178UBA0 | 7e-97 | A0A178UBA0_ARATH; Uncharacterized protein | ||||
| TrEMBL | A0A1P8BBX4 | 1e-96 | A0A1P8BBX4_ARATH; K-box region and MADS-box transcription factor family protein | ||||
| STRING | XP_010444476.1 | 1e-112 | (Camelina sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65050.2 | 7e-90 | AGAMOUS-like 31 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




