![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa12g008980.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 158aa MW: 17761.8 Da PI: 5.2486 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 37.1 | 6.9e-12 | 27 | 81 | 5 | 59 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
++ +r+ +NRe+ArrsR +K++ ++ L+ v L++eN + ++ ++++ ++
Csa12g008980.1 27 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENNEIVTSVSITTQHYLTV 81
7889**********************************98777666666666555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 3.9E-10 | 19 | 68 | No hit | No description |
| SMART | SM00338 | 2.5E-17 | 23 | 87 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.117 | 25 | 88 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 3.9E-9 | 26 | 67 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.88E-12 | 27 | 79 | No hit | No description |
| CDD | cd14702 | 4.40E-17 | 28 | 78 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 30 | 45 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MESSSSGTTS STIQSSSGSE ESLMEQRKRK RMLSNRESAR RSRMKKQKLL DDLTAQVNHL 60 KKENNEIVTS VSITTQHYLT VEAENSVLRA QLDELNHRLQ SLNDIIEFLD SNNNSNNGMC 120 SSNPLVGLEC DDFFVNQMNM SYMMNQPLMA SSDALLY* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 26 | 47 | RKRKRMLSNRESARRSRMKKQK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa12g008980.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL023094 | 0.0 | AL023094.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20 (ESSA project). | |||
| GenBank | AL161585 | 0.0 | AL161585.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81. | |||
| GenBank | AY063979 | 0.0 | AY063979.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds. | |||
| GenBank | AY096396 | 0.0 | AY096396.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds. | |||
| GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010447053.1 | 1e-111 | PREDICTED: bZIP transcription factor 11-like | ||||
| Swissprot | O65683 | 3e-87 | BZP11_ARATH; bZIP transcription factor 11 | ||||
| TrEMBL | D7MEC5 | 5e-90 | D7MEC5_ARALL; Transcription factor GBF6 | ||||
| STRING | XP_010447053.1 | 1e-110 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM501 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G34590.1 | 8e-82 | G-box binding factor 6 | ||||




