PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa12g023560.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

NZZ/SPL

Protein Properties

Length: 221aa MW: 24033.6 Da PI: 6.501

Description

NZZ/SPL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa12g023560.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NOZZLE	328.1	1.8e-100	1	220	106	314
NOZZLE 106 vdrgvvlqgfpsslgs...srilcggvgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrldgdqnnvvrsngggfs 197 vd+ +vlqgfpsslg+ +ri+cggvgsgq+m+dpv+ pwgfvets helssi+npqmyna s+ +cdtcfkkkr+d dqnnvvrsngggfs Csa12g023560.1 1 VDPVLVLQGFPSSLGGcrnNRIYCGGVGSGQIMMDPVCPPWGFVETSPHHHELSSIPNPQMYNAISDPHCDTCFKKKRVDEDQNNVVRSNGGGFS 95 7999*********99999*********************************************************************** PP NOZZLE 198 kytmipppmngydeyllqsdhhqrsqgflydq...riaraasvsaasasinpyfneatnltgsreefgs.vlegnprngs..rgvkeyeffpgky 286 kytm+ ppmngy++ llq+d+++ qgf+yd+ riar+a + ++as py+neatn+t s+ee+gs ++egnpr g +gv eyeffpgky Csa12g023560.1 96 KYTMVHPPMNGYEH-LLQPDYQRSNQGFMYDHhhhRIARSA--PPSAASTHPYLNEATNHTVSMEEYGSgYMEGNPRSGGsgGGVMEYEFFPGKY 187 ********99.*76667*95444999999..77778889*************989**9852368******* PP NOZZLE 287 de.rvskvakvaslvgdcspn....tidlslkl 314 d+ + + k s++ spn tidlslkl Csa12g023560.1 188 DDgFPGNYGKGVSSMATTSPNpsssTIDLSLKL 220 985668888999999999999*****8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08744	1.3E-96	1	220	IPR014855	Plant transcription factor NOZZLE

Sequence ? help Back to Top
Protein Sequence Length: 221 aa Download sequence Send to blast
VDPVLVLQGF PSSLGGCRNN RIYCGGVGSG QIMMDPVCPP WGFVETSPHH HELSSIPNPQ 60 MYNAISDPHC DTCFKKKRVD EDQNNVVRSN GGGFSKYTMV HPPMNGYEHL LQPDYQRSNQ 120 GFMYDHHHHR IARSAPPSAA STHPYLNEAT NHTVSMEEYG SGYMEGNPRS GGSGGGVMEY 180 EFFPGKYDDG FPGNYGKGVS SMATTSPNPS SSTIDLSLKL *

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator of sporocyte development (PubMed:10465788). Acts as an adapter-like transcriptional repressor recruiting TPL/TPR corepressors to inhibit TCP transcription factors (PubMed:25378179). Required for nucellus and embryo sac development (PubMed:10500234). Plays a central role in patterning both the proximal-distal and the adaxial-abaxial axes during ovule development (PubMed:12183381). Involved in establishing the prospective chalaza of the ovule and in controlling the cell number and the length of the funiculus, and is required for the development of the integuments (PubMed:10976054). Required, with BEL1, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). Involved in controlling stamen identity (PubMed:19726570). May also regulate the morphology of lateral organs by repressing auxin production (PubMed:18557819). {ECO:0000269\|PubMed:10465788, ECO:0000269\|PubMed:10500234, ECO:0000269\|PubMed:10976054, ECO:0000269\|PubMed:12183381, ECO:0000269\|PubMed:18557819, ECO:0000269\|PubMed:19726570, ECO:0000269\|PubMed:22786869, ECO:0000269\|PubMed:25378179}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa12g023560.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by the transcription factor AGAMOUS (PubMed:15254538). Regulated by ATXR3/SDG2 via chromatin methylation (PubMed:21037105). Triggered by TGA9 AND TGA10 in anthers (PubMed:20805327). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:20805327, ECO:0000269\|PubMed:21037105}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010448150.1	1e-165	PREDICTED: protein SPOROCYTELESS-like
Swissprot	O81836	1e-87	SPL_ARATH; Protein SPOROCYTELESS
TrEMBL	R0H320	1e-109	R0H320_9BRAS; Uncharacterized protein
STRING	XP_010448150.1	1e-165	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13435	18	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G27330.1	3e-86	sporocyteless (SPL)

Publications ? help Back to Top
Armenta-Medina A,Huanca-Mamani W,Sanchez-León N,Rodríguez-Arévalo I,Vielle-Calzada JP Functional analysis of sporophytic transcripts repressed by the female gametophyte in the ovule of Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e76977 [PMID:24194852] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Zhao L, et al. Comparative expression profiling reveals gene functions in female meiosis and gametophyte development in Arabidopsis. Plant J., 2014. 80(4): p. 615-28 [PMID:25182975] Yuan L,Sundaresan V Spore formation in plants: sporocyteless and more. Cell Res., 2015. 25(1): p. 7-8 [PMID:25512340] Picó S,Ortiz-Marchena MI,Merini W,Calonje M Deciphering the Role of POLYCOMB REPRESSIVE COMPLEX1 Variants in Regulating the Acquisition of Flowering Competence in Arabidopsis. Plant Physiol., 2015. 168(4): p. 1286-97 [PMID:25897002] Mao Y, et al. Development of germ-line-specific CRISPR-Cas9 systems to improve the production of heritable gene modifications in Arabidopsis. Plant Biotechnol. J., 2016. 14(2): p. 519-32 [PMID:26360626] Rojas-Gracia P, et al. The parthenocarpic hydra mutant reveals a new function for a SPOROCYTELESS-like gene in the control of fruit set in tomato. New Phytol., 2017. 214(3): p. 1198-1212 [PMID:28134991] Zhao F, et al. Phosphorylation of SPOROCYTELESS/NOZZLE by the MPK3/6 Kinase Is Required for Anther Development. Plant Physiol., 2017. 173(4): p. 2265-2277 [PMID:28209842] Bi H,Fan W,Zhang P C4 Protein of Sweet Potato Leaf Curl Virus Regulates Brassinosteroid Signaling Pathway through Interaction with AtBIN2 and Affects Male Fertility in Arabidopsis. Front Plant Sci, 2017. 8: p. 1689 [PMID:29021807]