![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa12g051780.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 65aa MW: 7117.34 Da PI: 10.8164 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 36.9 | 4.6e-12 | 18 | 57 | 4 | 43 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
+ k +r+v skRr++++ KA L+ L +a++av + s+
Csa12g051780.1 18 DTKQQRSVACSKRRQTLFSKAADLCLLSGANIAVFVTSPA 57
56899*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.3E-11 | 7 | 64 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 12.264 | 7 | 55 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 1.04E-18 | 8 | 64 | No hit | No description |
| SuperFamily | SSF55455 | 2.22E-13 | 9 | 58 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.5E-11 | 20 | 58 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MTMKRGGTKI KIEIKKRDTK QQRSVACSKR RQTLFSKAAD LCLLSGANIA VFVTSPAENN 60 DVVY* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa12g051780.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010451454.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL97 | ||||
| TrEMBL | R0H9P9 | 1e-29 | R0H9P9_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010451454.1 | 6e-34 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6395 | 14 | 42 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G48150.1 | 6e-31 | M-type_MADS family protein | ||||




