| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 133.9 | 1.1e-41 | 235 | 332 | 31 | 129 |
NAM 31 eevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmhe 125
+++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++lvg+kktLvfykgrapkg+kt+Wvmhe
Csa12g081820.1 235 ATAIGEVDLNKIEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFK-GKSLVGMKKTLVFYKGRAPKGVKTNWVMHE 328
3579**************888999****************************************.999*************************** PP
NAM 126 yrle 129
yrle
Csa12g081820.1 329 YRLE 332
**85 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 4e-40 | 233 | 362 | 44 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-40 | 233 | 362 | 44 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-40 | 233 | 362 | 44 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-40 | 233 | 362 | 44 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 5e-40 | 233 | 362 | 47 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 4e-40 | 233 | 362 | 44 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 4e-40 | 233 | 362 | 44 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:23340744, ECO:0000269|PubMed:23459204, ECO:0000269|PubMed:9351240}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19608714, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:20404534, ECO:0000269|PubMed:21511905, ECO:0000269|PubMed:22930749}. |