![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa13g003780.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 165aa MW: 18765 Da PI: 5.6419 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 72.6 | 7.4e-23 | 53 | 111 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k++++++d++l+ +isw +g sfvv+d+ efa+++Lp+ Fkh+nf+SFvRQLn+Y
Csa13g003780.1 53 FLSKTFDLVDDPTLDPVISWGLTGASFVVWDPLEFARTILPRNFKHNNFSSFVRQLNTY 111
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.4E-24 | 47 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.77E-21 | 48 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.1E-19 | 49 | 125 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 4.6E-19 | 53 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.2E-13 | 53 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.2E-13 | 91 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.2E-13 | 104 | 116 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MSPKKDDFFS KPTPISVPPG PLYCVDTDTM GSPPTPPLPI PLDILQGNQV PPFLSKTFDL 60 VDDPTLDPVI SWGLTGASFV VWDPLEFART ILPRNFKHNN FSSFVRQLNT YIVYMDAAKF 120 LFFFFFPFCF SIFLFVCVSV IFLMILKAHI SCIIVSRNWF FDYL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5hdk_A | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
| 5hdk_B | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
| 5hdk_C | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
| 5hdk_D | 1e-16 | 50 | 118 | 7 | 79 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa13g003780.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL162506 | 5e-65 | AL162506.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F17C15 (ESSA project). | |||
| GenBank | CP002688 | 5e-65 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019089984.1 | 7e-74 | PREDICTED: heat stress transcription factor A-3 | ||||
| Swissprot | Q8GYY1 | 1e-51 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
| TrEMBL | A0A178UJV3 | 4e-52 | A0A178UJV3_ARATH; HSFA3 | ||||
| TrEMBL | D7LWT0 | 1e-49 | D7LWT0_ARALL; AT-HSFA3 | ||||
| STRING | XP_010452265.1 | 2e-73 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22902 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G03720.1 | 3e-46 | heat shock transcription factor A3 | ||||




