![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa13g019630.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 99aa MW: 10903.2 Da PI: 7.3514 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 91.4 | 1.1e-28 | 28 | 91 | 2 | 65 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65
Fl+k+y++++d+ ++e++sws+ +nsfvv++ ef+k +LpkyFkh+nf+SFvRQLn+YgF+ +
Csa13g019630.1 28 FLSKTYDMVDDPLTNEVVSWSSGNNSFVVWNVPEFSKVLLPKYFKHNNFSSFVRQLNTYGFSLS 91
9************************************************************865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 7.4E-30 | 23 | 90 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.8E-25 | 24 | 98 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.04E-25 | 26 | 90 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 3.0E-18 | 28 | 51 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.5E-23 | 28 | 90 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.0E-18 | 66 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.0E-18 | 79 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MESVRESAPS ANSNTPTIPP PVNSVPPFLS KTYDMVDDPL TNEVVSWSSG NNSFVVWNVP 60 EFSKVLLPKY FKHNNFSSFV RQLNTYGFSL SPVSSNKC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5hdk_A | 9e-21 | 25 | 88 | 7 | 70 | Heat shock factor protein 2 |
| 5hdk_B | 9e-21 | 25 | 88 | 7 | 70 | Heat shock factor protein 2 |
| 5hdk_C | 9e-21 | 25 | 88 | 7 | 70 | Heat shock factor protein 2 |
| 5hdk_D | 9e-21 | 25 | 88 | 7 | 70 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa13g019630.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: DNA-binding capacity is reduced by HSBP in vitro. {ECO:0000269|PubMed:20388662}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC237334 | 4e-95 | AC237334.1 Arabidopsis lyrata clone JGIFAFI-61P18, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010453856.1 | 2e-55 | PREDICTED: heat stress transcription factor A-1b | ||||
| Swissprot | O81821 | 6e-51 | HFA1B_ARATH; Heat stress transcription factor A-1b | ||||
| TrEMBL | A0A178UCE2 | 2e-48 | A0A178UCE2_ARATH; HSFA1B | ||||
| STRING | XP_010453856.1 | 7e-55 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM965 | 28 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16820.2 | 1e-40 | heat shock factor 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




