PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa14039s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

Dof

Protein Properties

Length: 99aa MW: 10878.2 Da PI: 9.9301

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa14039s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	65.3	1e-20	66	99	4	37
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCr 37 ++++cprC+stntkfCyynnysl+qPryfCk+Cr Csa14039s010.1 66 EKINCPRCNSTNTKFCYYNNYSLTQPRYFCKGCR 99 789******************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-15	63	99	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.8E-17	67	99	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	18.967	68	99	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MMNVKPMDQI MIPNNSTHQS NTASNARPNA ILTSNGVSAA GTTVSGVSNN NNNTAVVAER 60 KARPLEKINC PRCNSTNTKF CYYNNYSLTQ PRYFCKGCR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the activation of a component that would trigger germination as a consequence of red light perception.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa14039s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC006418	1e-113	AC006418.4 Arabidopsis thaliana chromosome 2 clone F13A10 map CIC06C03, complete sequence.
GenBank	AJ237810	1e-113	AJ237810.1 Arabidopsis thaliana dag2 gene, exons 1-2.
GenBank	AJ237811	1e-113	AJ237811.1 Arabidopsis thaliana mRNA for putative DNA binding protein (partial).
GenBank	BT003328	1e-113	BT003328.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g46590) mRNA, complete cds.
GenBank	BT008842	1e-113	BT008842.1 Arabidopsis thaliana At2g46590 mRNA, complete cds.
GenBank	CP002685	1e-113	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010506672.1	5e-65	PREDICTED: dof zinc finger protein DOF2.5
Swissprot	Q9ZPY0	1e-56	DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBL	A0A0D3B710	4e-56	A0A0D3B710_BRAOL; Uncharacterized protein
STRING	XP_010506672.1	2e-64	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2528	26	73

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46590.1	9e-49	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]