![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa15g010750.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 74aa MW: 8678.02 Da PI: 11.4374 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 32 | 2.9e-10 | 38 | 67 | 18 | 48 |
HTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 18 qlGggtWktIartmgkgRtlkqcksrwqkyl 48
++G+ W+ Ia+ ++ gR +kqc++rw+++l
Csa15g010750.1 38 RYGPAKWSVIAQSLP-GRIGKQCRERWHNHL 67
588889*********.*************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.687 | 8 | 71 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-14 | 38 | 72 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.19E-7 | 38 | 67 | No hit | No description |
| SuperFamily | SSF46689 | 2.77E-11 | 38 | 71 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 7.9E-9 | 38 | 67 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MMISSISVID KRRAEFFQDR TEVQCLHRRM RKSLNSLRYG PAKWSVIAQS LPGRIGKQCR 60 ERWHNHLNPD INN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h88_C | 5e-17 | 14 | 71 | 33 | 108 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 5e-17 | 14 | 71 | 33 | 108 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa15g010750.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by ethylene, auxin (IAA), jasmonic acid (JA) and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF214117 | 1e-48 | AF214117.2 Arabidopsis thaliana putative c-myb-like transcription factor (MYB3R3) mRNA, complete cds. | |||
| GenBank | AY034964 | 1e-48 | AY034964.1 Arabidopsis thaliana putative MYB family transcription factor (At3g09370) mRNA, complete cds. | |||
| GenBank | AY142649 | 1e-48 | AY142649.1 Arabidopsis thaliana putative MYB family transcription factor (At3g09370) mRNA, complete cds. | |||
| GenBank | AY519651 | 1e-48 | AY519651.1 Arabidopsis thaliana MYB transcription factor (At3g09370) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010486504.1 | 1e-24 | PREDICTED: transcriptional activator Myb-like isoform X1 | ||||
| Refseq | XP_010486505.1 | 1e-24 | PREDICTED: transcriptional activator Myb-like isoform X2 | ||||
| Refseq | XP_019092165.1 | 1e-26 | PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like | ||||
| Swissprot | Q8H1P9 | 2e-22 | MB3R3_ARATH; Transcription factor MYB3R-3 | ||||
| TrEMBL | A0A446NVV5 | 2e-22 | A0A446NVV5_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A453FWM6 | 1e-22 | A0A453FWM6_AEGTS; Uncharacterized protein | ||||
| STRING | XP_010486504.1 | 5e-24 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM27405 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09370.2 | 6e-26 | myb domain protein 3r-3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




