![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa16998s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 73aa MW: 8888.92 Da PI: 10.9386 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 43.9 | 5.4e-14 | 26 | 73 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
+++rr+++NRe+ArrsR RK+ ++eL v L eN++L ++l++l
Csa16998s010.1 26 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNL 73
68******************************************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 4.5E-4 | 22 | 73 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.714 | 24 | 73 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.34E-13 | 26 | 72 | No hit | No description |
| Pfam | PF00170 | 3.7E-12 | 26 | 73 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 2.1E-11 | 26 | 73 | No hit | No description |
| CDD | cd14702 | 1.66E-12 | 27 | 73 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 29 | 44 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MSLSSNNSTS DEAEEHQTNN NIINERKQRR MISNRESARR SRMRKQRHLD ELWSQVMWLR 60 IENHQLLDKL NNL |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 38 | 45 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa16998s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB016878 | 7e-93 | AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15. | |||
| GenBank | AB493637 | 7e-93 | AB493637.1 Arabidopsis thaliana At3g30530 mRNA for hypothetical protein, partial cds, clone: RAAt3g30530. | |||
| GenBank | CP002686 | 7e-93 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010496052.1 | 5e-45 | PREDICTED: basic leucine zipper 43-like | ||||
| Swissprot | Q9FMC2 | 8e-30 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A384LDW0 | 2e-42 | A0A384LDW0_ARATH; BZIP42 | ||||
| TrEMBL | Q9LW45 | 2e-42 | Q9LW45_ARATH; Basic leucine-zipper 42 | ||||
| STRING | XP_010496052.1 | 2e-44 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3112 | 26 | 67 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30530.1 | 2e-47 | basic leucine-zipper 42 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




