PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa16g032090.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

TALE

Protein Properties

Length: 135aa MW: 15809.5 Da PI: 5.3205

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa16g032090.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	29.9	9.6e-10	77	111	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++ ++ LA+++gL+++q+ +WF N+R ++ Csa16g032090.1 77 RWPYPTEGDKIALAEETGLDQKQINNWFINQRKRH 111 569*****************************985 PP
2	ELK	31.9	2.9e-11	31	52	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK+ LlrK++++++sLk EFs Csa16g032090.1 31 DLKDLLLRKFGSHISSLKLEFS 52 69*******************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51213	9.568	31	51	IPR005539	ELK domain
Pfam	PF03789	3.2E-7	31	52	IPR005539	ELK domain
SMART	SM01188	1.0E-4	31	52	IPR005539	ELK domain
PROSITE profile	PS50071	12.698	51	114	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.48E-20	52	125	IPR009057	Homeodomain-like
SMART	SM00389	6.6E-13	53	118	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	4.3E-28	56	115	IPR009057	Homeodomain-like
CDD	cd00086	1.66E-11	60	115	No hit	No description
Pfam	PF05920	4.8E-18	71	110	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	89	112	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
DDGAVSSDEE LREADDDVAA HESQQRNNDR DLKDLLLRKF GSHISSLKLE FSKKKKKGKL 60 PREARQALLD WWNVHYRWPY PTEGDKIALA EETGLDQKQI NNWFINQRKR HWKPSENMPF 120 AMMDDSSDTF FTEE*

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa16g032090.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	X81353	1e-150	X81353.1 A.thaliana mRNA for ATK1 protein.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010471046.1	8e-95	PREDICTED: homeobox protein knotted-1-like 2
Swissprot	P46640	2e-78	KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBL	A0A0D3APM9	2e-78	A0A0D3APM9_BRAOL; Uncharacterized protein
STRING	XP_010471046.1	3e-94	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM835	27	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G70510.1	8e-62	KNOTTED-like from Arabidopsis thaliana 2

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zhang XL,Yang ZP,Zhang J,Zhang LG Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana. Int J Mol Sci, 2013. 14(7): p. 14872-91 [PMID:23863694] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171]