PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa17090s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

SBP

Protein Properties

Length: 99aa MW: 11022.3 Da PI: 9.415

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa17090s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	75.3	9.9e-24	52	99	1	48
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr Csa17090s010.1 52 RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSR 99 6**********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.3E-25	48	99	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	20.64	50	99	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.31E-22	51	99	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.9E-17	53	99	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
KTEVDFTSNR IGLNLGGRTY FSAADDDFVS RLYRRSRPGE SGMGNSPLST PRCQAEGCNA 60 DLSHAKHYHR RHKVCEFHSK ASTVVAAGLS QRFCQQCSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	7e-18	53	99	6	52	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa17090s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ011641	2e-97	AJ011641.1 Arabidopsis thaliana (ecotype Columbia) spl8 gene, exons 1-3.
GenBank	AJ011642	2e-97	AJ011642.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 8.
GenBank	AK118174	2e-97	AK118174.1 Arabidopsis thaliana At1g02065 mRNA for putative squamosa promoter binding protein 8 (SPL8), complete cds, clone: RAFL19-49-D21.
GenBank	CP002684	2e-97	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBank	U89959	2e-97	U89959.1 Arabidopsis thaliana BAC T7I23, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010480322.1	1e-68	PREDICTED: squamosa promoter-binding-like protein 8, partial
Swissprot	Q8GXL3	3e-64	SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBL	R0GQ55	2e-63	R0GQ55_9BRAS; Uncharacterized protein
STRING	Cagra.1968s0141.1.p	2e-66	(Capsella grandiflora)
STRING	XP_010480322.1	5e-68	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7010	27	43

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.2	4e-68	squamosa promoter binding protein-like 8

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384]