![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa17g019830.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 146aa MW: 16229.5 Da PI: 8.4296 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 135.5 | 2.5e-42 | 12 | 98 | 1 | 87 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsne 87
s+yk+kaal+v++++p+f+aldsg++kl+++G+lll++a+++++r+ydW+kkq+f+ls+te+++lv+l++kesceffhdp++++ e
Csa17g019830.1 12 SIYKGKAALTVDPRAPEFVALDSGAFKLSKDGFLLLQFAPSAGVRQYDWSKKQVFSLSVTEIGTLVSLGPKESCEFFHDPFKGKRAE 98
7********************************************************************************987654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.5E-42 | 3 | 95 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 3.53E-54 | 6 | 146 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 9.9E-37 | 13 | 98 | IPR013742 | Plant transcription factor |
| Gene3D | G3DSA:2.30.31.10 | 2.2E-9 | 96 | 130 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
EGSPARFYVG HSIYKGKAAL TVDPRAPEFV ALDSGAFKLS KDGFLLLQFA PSAGVRQYDW 60 SKKQVFSLSV TEIGTLVSLG PKESCEFFHD PFKGKRAEFA VLISAFNFVL PYLIGWHAFA 120 NSIKPEDANK MNNALPNYGG DYEWNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4koo_A | 2e-77 | 1 | 124 | 3 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_B | 2e-77 | 1 | 124 | 3 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_C | 2e-77 | 1 | 124 | 3 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_D | 2e-77 | 1 | 124 | 3 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa17g019830.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF332452 | 1e-107 | AF332452.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
| GenBank | AF370156 | 1e-107 | AF370156.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
| GenBank | AY059097 | 1e-107 | AY059097.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010480475.1 | 3e-96 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| Swissprot | Q9M9S3 | 4e-92 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | R0GJR8 | 2e-92 | R0GJR8_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010480475.1 | 1e-95 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5023 | 27 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14410.1 | 1e-94 | ssDNA-binding transcriptional regulator | ||||




