![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa17g048850.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 130aa MW: 14854.5 Da PI: 4.1795 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.1 | 6.9e-25 | 16 | 74 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+ye+++d++ ++++sws++++sf+v+++ ef++++Lp++Fkh+nf SF+RQLn+Y
Csa17g048850.2 16 FLTKTYEMVDDSSSDSIVSWSQSNKSFIVWNPPEFSRDLLPRFFKHNNFLSFIRQLNTY 74
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 6.8E-27 | 9 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 3.26E-24 | 11 | 82 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.6E-27 | 12 | 121 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.7E-14 | 16 | 39 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 7.3E-21 | 16 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.7E-14 | 54 | 66 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.7E-14 | 67 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MDESNHGGSS SSLPPFLTKT YEMVDDSSSD SIVSWSQSNK SFIVWNPPEF SRDLLPRFFK 60 HNNFLSFIRQ LNTYVSVVAK YIDSEREWRL KMLEDESDPS DPDFGISDED DNDSQVLPIA 120 DPMKMMMKS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 8e-18 | 11 | 104 | 24 | 115 | Heat shock factor protein 1 |
| 5d5v_B | 8e-18 | 11 | 104 | 24 | 115 | Heat shock factor protein 1 |
| 5d5v_D | 8e-18 | 11 | 104 | 24 | 115 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa17g048850.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL021711 | 2e-85 | AL021711.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5 (ESSA project). | |||
| GenBank | AL161549 | 2e-85 | AL161549.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 49. | |||
| GenBank | CP002687 | 2e-85 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010449453.1 | 4e-44 | PREDICTED: heat stress transcription factor A-4a | ||||
| Refseq | XP_010449454.1 | 4e-44 | PREDICTED: heat stress transcription factor A-4a | ||||
| Refseq | XP_010449455.1 | 4e-44 | PREDICTED: heat stress transcription factor A-4a | ||||
| Refseq | XP_010449456.1 | 4e-44 | PREDICTED: heat stress transcription factor A-4a | ||||
| Swissprot | O49403 | 1e-32 | HFA4A_ARATH; Heat stress transcription factor A-4a | ||||
| TrEMBL | A0A3P6BR83 | 3e-37 | A0A3P6BR83_BRACM; Uncharacterized protein | ||||
| STRING | XP_010449453.1 | 2e-43 | (Camelina sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18880.1 | 5e-33 | heat shock transcription factor A4A | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




