PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g003570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB_related
Protein Properties Length: 147aa    MW: 16822.7 Da    PI: 6.7984
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g003570.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.2e-191257148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg +T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
   Csa19g003570.1 12 RGHFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 57
                     899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.45E-17567IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-25561IPR009057Homeodomain-like
PROSITE profilePS5129428.439761IPR017930Myb domain
SMARTSM007174.8E-181159IPR001005SANT/Myb domain
PfamPF002498.3E-181257IPR001005SANT/Myb domain
CDDcd001673.02E-141557No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
QLNLYXSPNV KRGHFTDQEE DLIIRLHKLL GNRWSLIAKR VPGRTDNQVK NYWNTHLSKK  60
IGTENQTIKS ISNQMNNLGN MTDASEERLL NVKFDNKSIL GDERLLMSEG LGLLHQASSS  120
LWGHHEDAFE PNTLTYMMDF IDGQCY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1556352110B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa19g003570.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937493e-41AB493749.1 Arabidopsis thaliana At5g14750 mRNA for hypothetical protein, partial cds, clone: RAAt5g14750.
GenBankAY5196233e-41AY519623.1 Arabidopsis thaliana MYB transcription factor (At5g14750) mRNA, complete cds.
GenBankBT0263463e-41BT026346.1 Arabidopsis thaliana At5g14750 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010489643.11e-105PREDICTED: transcription factor WER-like
SwissprotQ9SEI07e-52WER_ARATH; Transcription factor WER
TrEMBLA0A1J3DFG53e-73A0A1J3DFG5_NOCCA; Transcription factor WER (Fragment)
TrEMBLA0A1J3GLK57e-74A0A1J3GLK5_NOCCA; Transcription factor WER (Fragment)
STRINGXP_010489643.11e-104(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2108535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-54myb domain protein 66
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Cheng Y, et al.
    Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
    Elife, 2018.
    [PMID:24771765]
  3. Kiefer CS, et al.
    Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(5): p. 1022
    [PMID:25715402]
  4. Kwak SH,Song SK,Lee MM,Schiefelbein J
    TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(12): p. e1103407
    [PMID:26451798]
  5. Zhu Y, et al.
    The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
    Plant Cell, 2017. 29(2): p. 260-276
    [PMID:28138017]
  6. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  7. Mira MM, et al.
    Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
    J. Exp. Bot., 2017. 68(20): p. 5653-5668
    [PMID:29059380]
  8. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]