![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa19g003570.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 147aa MW: 16822.7 Da PI: 6.7984 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.5 | 7.2e-19 | 12 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg +T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
Csa19g003570.1 12 RGHFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 57
899*******************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 5.45E-17 | 5 | 67 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 7.6E-25 | 5 | 61 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 28.439 | 7 | 61 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.8E-18 | 11 | 59 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.3E-18 | 12 | 57 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.02E-14 | 15 | 57 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
QLNLYXSPNV KRGHFTDQEE DLIIRLHKLL GNRWSLIAKR VPGRTDNQVK NYWNTHLSKK 60 IGTENQTIKS ISNQMNNLGN MTDASEERLL NVKFDNKSIL GDERLLMSEG LGLLHQASSS 120 LWGHHEDAFE PNTLTYMMDF IDGQCY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-15 | 5 | 63 | 52 | 110 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa19g003570.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493749 | 3e-41 | AB493749.1 Arabidopsis thaliana At5g14750 mRNA for hypothetical protein, partial cds, clone: RAAt5g14750. | |||
| GenBank | AY519623 | 3e-41 | AY519623.1 Arabidopsis thaliana MYB transcription factor (At5g14750) mRNA, complete cds. | |||
| GenBank | BT026346 | 3e-41 | BT026346.1 Arabidopsis thaliana At5g14750 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010489643.1 | 1e-105 | PREDICTED: transcription factor WER-like | ||||
| Swissprot | Q9SEI0 | 7e-52 | WER_ARATH; Transcription factor WER | ||||
| TrEMBL | A0A1J3DFG5 | 3e-73 | A0A1J3DFG5_NOCCA; Transcription factor WER (Fragment) | ||||
| TrEMBL | A0A1J3GLK5 | 7e-74 | A0A1J3GLK5_NOCCA; Transcription factor WER (Fragment) | ||||
| STRING | XP_010489643.1 | 1e-104 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM21085 | 3 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G14750.1 | 3e-54 | myb domain protein 66 | ||||




