![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa20426s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 72aa MW: 8338.65 Da PI: 11.1567 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 126.6 | 7.3e-40 | 14 | 71 | 3 | 60 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
e+al+cprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+
Csa20426s010.1 14 EAALNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKR 71
6789****************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-36 | 1 | 71 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 5.8E-34 | 15 | 71 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.236 | 17 | 71 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 19 | 55 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MVERARIAKV PLPEAALNCP RCDSTNTKFC YFNNYSLTQP RHFCKTCRRY WTRGGALRNV 60 PVGGGFRRNK RS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa20426s010.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493653 | 3e-98 | AB493653.1 Arabidopsis thaliana At3g55370 mRNA for hypothetical protein, partial cds, clone: RAAt3g55370. | |||
| GenBank | AF155818 | 3e-98 | AF155818.1 Arabidopsis thaliana zinc finger protein OBP3 mRNA, complete cds. | |||
| GenBank | AK221402 | 3e-98 | AK221402.1 Arabidopsis thaliana mRNA for zinc finger protein OBP3, complete cds, clone: RAFL25-48-C17. | |||
| GenBank | AL132975 | 3e-98 | AL132975.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T22E16. | |||
| GenBank | BT033028 | 3e-98 | BT033028.1 Arabidopsis thaliana unknown protein (At3g55370) mRNA, complete cds. | |||
| GenBank | CP002686 | 3e-98 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006291398.1 | 1e-47 | dof zinc finger protein DOF3.6 isoform X1 | ||||
| Swissprot | Q9M2U1 | 4e-48 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
| TrEMBL | R0FQ93 | 3e-46 | R0FQ93_9BRAS; Uncharacterized protein | ||||
| STRING | XP_006291398.1 | 5e-47 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1713 | 28 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G55370.1 | 2e-50 | OBF-binding protein 3 | ||||




