![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa21991s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | BBR-BPC | ||||||||
| Protein Properties | Length: 87aa MW: 9552.09 Da PI: 9.4244 | ||||||||
| Description | BBR-BPC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GAGA_bind | 203.1 | 2.9e-62 | 1 | 87 | 203 | 289 |
GAGA_bind 203 lDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhW 289
+D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRi+grKmSqgafkk+LekLa+eGy+++n++DLk+hW
Csa21991s010.1 1 MDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEGYSFGNAIDLKSHW 87
8************************************************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01226 | 3.4E-13 | 1 | 87 | IPR010409 | GAGA-binding transcriptional activator |
| Pfam | PF06217 | 3.1E-58 | 1 | 87 | IPR010409 | GAGA-binding transcriptional activator |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MDISGLPVPV CTCTGTPQQC YRWGCGGWQS ACCTTNISMY PLPMSTKRRG ARISGRKMSQ 60 GAFKKVLEKL ATEGYSFGNA IDLKSHW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa21991s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC254589 | 1e-108 | AC254589.1 Capsella rubella clone CAP16-D05, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010502189.1 | 6e-60 | PREDICTED: protein BASIC PENTACYSTEINE1 | ||||
| Refseq | XP_010502201.1 | 6e-60 | PREDICTED: protein BASIC PENTACYSTEINE1-like | ||||
| Swissprot | Q9SKD0 | 1e-59 | BPC1_ARATH; Protein BASIC PENTACYSTEINE1 | ||||
| TrEMBL | R0HH84 | 4e-58 | R0HH84_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010502189.1 | 2e-59 | (Camelina sativa) | ||||
| STRING | XP_010502201.1 | 2e-59 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6169 | 26 | 47 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G01930.2 | 4e-62 | basic pentacysteine1 | ||||




