![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa22131s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 66aa MW: 7260.6 Da PI: 10.4825 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 63.3 | 6.1e-20 | 20 | 65 | 1 | 46 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
+CaaCk+lrr+Ca++C+++pyf ++p+kfa vhk+FGasnv+k+l
Csa22131s010.1 20 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKML 65
7*******************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 16.568 | 19 | 66 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.3E-19 | 20 | 65 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MAGIRRPMSG PPGTLNTITP CAACKLLRRR CAQECPFSPY FSPHEPHKFA SVHKVFGASN 60 VSKMLM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-18 | 12 | 65 | 3 | 56 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-18 | 12 | 65 | 3 | 56 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa22131s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC254595 | 3e-92 | AC254595.1 Capsella rubella clone CAP16-M18, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001324899.1 | 1e-42 | LOB domain-containing protein 15 | ||||
| Refseq | NP_565933.1 | 2e-42 | LOB domain-containing protein 15 | ||||
| Refseq | XP_009133436.1 | 2e-42 | PREDICTED: LOB domain-containing protein 15 isoform X1 | ||||
| Refseq | XP_013734516.1 | 2e-42 | LOB domain-containing protein 15 | ||||
| Refseq | XP_020882787.1 | 1e-42 | LOB domain-containing protein 15 isoform X2 | ||||
| Swissprot | Q8L5T5 | 2e-43 | LBD15_ARATH; LOB domain-containing protein 15 | ||||
| TrEMBL | M4C7L0 | 2e-41 | M4C7L0_BRARP; Uncharacterized protein | ||||
| STRING | Bra000188.1-P | 3e-42 | (Brassica rapa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G40470.1 | 7e-46 | LOB domain-containing protein 15 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




