![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa23746s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 76aa MW: 8691.95 Da PI: 5.642 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 98.1 | 1.3e-30 | 1 | 76 | 230 | 305 |
GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaer 305
+vkslsPkvv++veqe+++n++ F+ rf+e+++yy+a+f+s++++lpr++++ri+vE+++l+r++vn++acega+r
Csa23746s010.1 1 MVKSLSPKVVTLVEQESNTNTAAFFPRFMETMNYYAAMFESIDVTLPRDHKQRINVEQHCLARDVVNIIACEGADR 76
69***********************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03514 | 4.6E-28 | 1 | 76 | IPR005202 | Transcription factor GRAS |
| PROSITE profile | PS50985 | 19.456 | 1 | 76 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MVKSLSPKVV TLVEQESNTN TAAFFPRFME TMNYYAAMFE SIDVTLPRDH KQRINVEQHC 60 LARDVVNIIA CEGADR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa23746s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB023039 | 1e-105 | AB023039.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIF21. | |||
| GenBank | AF153443 | 1e-105 | AF153443.1 Arabidopsis thaliana phytochrome A signal transduction 1 protein (PAT1) mRNA, complete cds. | |||
| GenBank | AK117483 | 1e-105 | AK117483.1 Arabidopsis thaliana At5g48150 mRNA for putative SCARECROW gene regulator, complete cds, clone: RAFL17-10-L05. | |||
| GenBank | AK317252 | 1e-105 | AK317252.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-43-D17. | |||
| GenBank | AK317747 | 1e-105 | AK317747.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-04-F15. | |||
| GenBank | BT025326 | 1e-105 | BT025326.1 Arabidopsis thaliana At5g48150 mRNA, complete cds. | |||
| GenBank | CP002688 | 1e-105 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010482060.1 | 2e-47 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_010482061.1 | 2e-47 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_010482062.1 | 2e-47 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Refseq | XP_010482063.1 | 2e-47 | PREDICTED: scarecrow-like transcription factor PAT1 | ||||
| Swissprot | Q9LDL7 | 2e-48 | PAT1_ARATH; Scarecrow-like transcription factor PAT1 | ||||
| TrEMBL | D7ML26 | 4e-46 | D7ML26_ARALL; Uncharacterized protein | ||||
| TrEMBL | R0G9L1 | 5e-46 | R0G9L1_9BRAS; Uncharacterized protein | ||||
| STRING | XP_010482060.1 | 7e-47 | (Camelina sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48150.2 | 9e-51 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




