![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Csa31362s010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 66aa MW: 7622.79 Da PI: 7.2588 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 119.3 | 1.7e-37 | 1 | 66 | 8 | 73 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73
+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++
Csa31362s010.1 1 MPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSK 66
8***************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.15E-26 | 1 | 65 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 5.1E-34 | 1 | 66 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-25 | 1 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.0E-11 | 28 | 46 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 31 | 47 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.0E-11 | 47 | 65 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MPIANVIRIM RRILPAHAKI SDDSKETIQE CVSEYISFIT GEANERCQRE QRKTITAEDV 60 LWAMSK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-43 | 1 | 66 | 13 | 78 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Csa31362s010.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB025628 | 4e-97 | AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7. | |||
| GenBank | AY138461 | 4e-97 | AY138461.1 Arabidopsis thaliana leafy cotyledon 1-like L1L protein mRNA, complete cds. | |||
| GenBank | CP002688 | 4e-97 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013728330.1 | 3e-42 | nuclear transcription factor Y subunit B-6 | ||||
| Refseq | XP_018456262.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X2 | ||||
| Refseq | XP_018456265.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X2 | ||||
| Refseq | XP_018456756.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Refseq | XP_018456757.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Refseq | XP_018456758.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Refseq | XP_018456759.1 | 3e-42 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 2e-42 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A078HWC2 | 4e-41 | A0A078HWC2_BRANA; BnaA09g18420D protein | ||||
| STRING | Bra024924.1-P | 3e-41 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM9896 | 26 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 4e-45 | nuclear factor Y, subunit B6 | ||||




