PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa34414s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

NAC

Protein Properties

Length: 52aa MW: 6067.02 Da PI: 4.367

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa34414s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	58.8	1.9e-18	7	52	1	47
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL 47 lppGfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++Pw+L Csa34414s010.1 7 LPPGFRFHPTDEELVMHYLCRKCASQSIAV-PIIAEIDLYKYDPWEL 52 79***********************999.88**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.01E-19	4	52	IPR003441	NAC domain
PROSITE profile	PS51005	21.451	7	52	IPR003441	NAC domain
Pfam	PF02365	1.0E-8	8	50	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 52 aa Download sequence Send to blast
MSAELELPPG FRFHPTDEEL VMHYLCRKCA SQSIAVPIIA EIDLYKYDPW EL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-24	3	52	11	60	Stress-induced transcription factor NAC1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa34414s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF370617	3e-51	AF370617.1 Arabidopsis thaliana OsNAC6 protein-like protein (T1N6.12) mRNA, complete cds.
GenBank	AK226385	3e-51	AK226385.1 Arabidopsis thaliana mRNA for hypothetical protein with NAC domain protein, complete cds, clone: RAFL05-19-I05.
GenBank	AY050799	3e-51	AY050799.1 Arabidopsis thaliana At1g01720 mRNA sequence.
GenBank	AY086063	3e-51	AY086063.1 Arabidopsis thaliana clone 20909 mRNA, complete sequence.
GenBank	BT024513	3e-51	BT024513.1 Arabidopsis thaliana At1g01720 mRNA, complete cds.
GenBank	CP002684	3e-51	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBank	T1N6	3e-51	AC009273.2 Sequence of BAC T1N6 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBank	X74755	3e-51	X74755.1 A.thaliana ATAF1 mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010479865.1	1e-30	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	4e-29	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A2I4HBT5	3e-28	A0A2I4HBT5_JUGRE; NAC domain-containing protein 2-like
TrEMBL	F6KVS9	4e-28	F6KVS9_9ROSI; Nam-like protein
STRING	XP_010479865.1	4e-30	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	2e-31	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]