PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.025370.1

Common Name

Csa_7G395250, LOC101204763

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

NF-YB

Protein Properties

Length: 152aa MW: 16592.3 Da PI: 4.8821

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.025370.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	170.7	1.7e-53	45	141	1	97
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 v+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++ alatlGf+dy+epl+ yl +yr++eg Cucsa.025370.1 45 VKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICCALATLGFDDYAEPLRRYLVRYRDMEG 139 58********************************************************************************************* PP NF-YB 96 ek 97 e+ Cucsa.025370.1 140 ER 141 97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.5E-50	44	146	IPR009072	Histone-fold
SuperFamily	SSF47113	6.52E-38	48	146	IPR009072	Histone-fold
Pfam	PF00808	1.3E-27	51	115	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.0E-17	79	97	No hit	No description
PROSITE pattern	PS00685	0	82	98	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.0E-17	98	116	No hit	No description
PRINTS	PR00615	1.0E-17	117	135	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 152 aa Download sequence Send to blast
MDENTGMPER SIEFKYDFTG GGSSGVGGST GGSSEEAGYG VGGVVKEQDR LLPIANVGRI 60 MKQILPPNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICCALATLGF 120 DDYAEPLRRY LVRYRDMEGE RAQQNKGCCN NX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-43	45	136	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-43	45	136	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681803	0.0	LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBank	LN713255	0.0	LN713255.1 Cucumis melo genomic chromosome, chr_1.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008451614.1	1e-108	PREDICTED: nuclear transcription factor Y subunit B-1
Refseq	XP_011659350.1	1e-108	PREDICTED: nuclear transcription factor Y subunit B-5
Swissprot	O82248	3e-57	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A0A0K954	1e-106	A0A0A0K954_CUCSA; Uncharacterized protein
TrEMBL	A0A1S3BT19	1e-106	A0A1S3BT19_CUCME; nuclear transcription factor Y subunit B-1
STRING	XP_008451614.1	1e-107	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	5e-59	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Cucsa.025370.1
Entrez Gene	101204763

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]