PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.046290.1

Common Name

Csa_6G517940, LOC101204761

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

Dof

Protein Properties

Length: 122aa MW: 13835.5 Da PI: 10.4101

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.046290.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.3	1.7e-38	19	77	3	61
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 + +kcprCds ntkfCyynnyslsqPry+Ck+CrryWt+GG+lrnvPvGgg+rk k+ Cucsa.046290.1 19 PQPQKCPRCDSLNTKFCYYNNYSLSQPRYLCKTCRRYWTHGGTLRNVPVGGGCRKGKRL 77 5789***************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	1.3E-33	21	76	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.491	22	76	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	3.0E-24	23	76	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	24	60	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MQYQDRRLKS VQVQDQVQPQ PQKCPRCDSL NTKFCYYNNY SLSQPRYLCK TCRRYWTHGG 60 TLRNVPVGGG CRKGKRLKQP SQSSNNSSVK PLVQTSASPL PPPQIVPLSL STTTSQHVIY 120 SX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681875	1e-172	LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBank	LN713262	1e-172	LN713262.1 Cucumis melo genomic chromosome, chr_8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004134954.1	8e-84	PREDICTED: dof zinc finger protein DOF1.4-like
Swissprot	Q8LDR0	6e-33	DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBL	A0A0A0KLH8	2e-82	A0A0A0KLH8_CUCSA; Uncharacterized protein
STRING	XP_004155647.1	3e-83	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4145	32	58

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	1e-34	OBF binding protein 4

Link Out ? help Back to Top
Phytozome	Cucsa.046290.1
Entrez Gene	101204761

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu P,Chen H,Ying L,Cai W AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana. Sci Rep, 2016. 6: p. 27705 [PMID:27297966] Ramirez-Parra E, et al. The transcription factor OBP4 controls root growth and promotes callus formation. New Phytol., 2017. 213(4): p. 1787-1801 [PMID:27859363] Rymen B, et al. ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator. Plant Physiol., 2017. 173(3): p. 1750-1762 [PMID:28167701]