![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.087850.1 | ||||||||
| Common Name | Csa_2G406060, LOC101212622 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 133aa MW: 15573.5 Da PI: 9.3183 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 101.2 | 6.2e-32 | 49 | 107 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYY+C+ +gC+vkk+++r ++d+ vv +tYeg H h+
Cucsa.087850.1 49 LDDGYRWRKYGQKAVKNNKFPRSYYKCSNEGCKVKKQIQRLTNDEGVVLTTYEGVHSHP 107
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 5.7E-33 | 34 | 107 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.22E-28 | 42 | 108 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.138 | 44 | 109 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.9E-36 | 49 | 108 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 6.4E-26 | 50 | 107 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MDEEEDDELE EERSLKKVKS EESGGELKKK KKIRKRRFAF ETRSQVDVLD DGYRWRKYGQ 60 KAVKNNKFPR SYYKCSNEGC KVKKQIQRLT NDEGVVLTTY EGVHSHPIEK PHDSFQNILT 120 HMHIYPSSSS SF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-27 | 39 | 106 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-27 | 39 | 106 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681815 | 3e-75 | LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008. | |||
| GenBank | LN713257 | 3e-75 | LN713257.1 Cucumis melo genomic chromosome, chr_3. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004138624.2 | 2e-94 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Swissprot | Q9S763 | 1e-49 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
| TrEMBL | A0A0A0LT01 | 5e-93 | A0A0A0LT01_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004138624.1 | 8e-94 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1156 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01970.1 | 4e-50 | WRKY DNA-binding protein 45 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.087850.1 |
| Entrez Gene | 101212622 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




