![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.095770.1 | ||||||||
| Common Name | Csa_4G007650 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 102aa MW: 11205.6 Da PI: 10.948 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 39.7 | 1.2e-12 | 7 | 58 | 2 | 55 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+y+GVr + +g+ + I+ p+++ k+k+ ++g+f+t+e+Aa a++a ++ ++g
Cucsa.095770.1 7 RYRGVRKRG-WGKCTSAIYYPKQG-KQKQLWIGSFDTPEMAATAYDAVANFFHG 58
8*****999.***88887777543.58************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd00018 | 7.70E-19 | 6 | 68 | No hit | No description |
| SMART | SM00380 | 1.7E-20 | 7 | 72 | IPR001471 | AP2/ERF domain |
| PROSITE profile | PS51032 | 18.373 | 7 | 66 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 9.7E-8 | 7 | 58 | IPR001471 | AP2/ERF domain |
| Gene3D | G3DSA:3.30.730.10 | 4.2E-22 | 7 | 67 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 3.07E-17 | 7 | 67 | IPR016177 | DNA-binding domain |
| PRINTS | PR00367 | 1.1E-7 | 8 | 19 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 1.1E-7 | 32 | 48 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MGDPLKRYRG VRKRGWGKCT SAIYYPKQGK QKQLWIGSFD TPEMAATAYD AVANFFHGPK 60 ARLNFPELRH TLPKFPPDAT VRKIRALARG AAEGSHGGGG GX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004152323.1 | 3e-70 | PREDICTED: ethylene-responsive transcription factor ERF021-like | ||||
| Swissprot | Q9C9I2 | 1e-22 | ERF21_ARATH; Ethylene-responsive transcription factor ERF021 | ||||
| TrEMBL | A0A0A0KTL4 | 1e-68 | A0A0A0KTL4_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004157010.1 | 1e-69 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1777 | 31 | 91 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71450.1 | 6e-25 | ERF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.095770.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




