PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.113300.1

Common Name

Csa_1G039270, LOC101204687

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

TCP

Protein Properties

Length: 125aa MW: 14311.6 Da PI: 10.5813

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.113300.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	87	4.4e-27	28	109	3	88
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 g+kdrhsk++T +g+RdRR+Rls+++a++++dLq++LG+ ++sk i+WL+ +i++l+ +++++ + + s ++s +g Cucsa.113300.1 28 GGKDRHSKVCTIKGLRDRRIRLSIPTAIQLYDLQNKLGLSQPSKVIDWLIDVTRFEIDKLPPLPFPKDFDP----NASILHHSDIG 109 68*************************************************************77666333....11122222333 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	1.0E-24	29	99	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	25.948	29	87	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 125 aa Download sequence Send to blast
MKKARTCSRQ GQFLRGNPRI FRVSPFFGGK DRHSKVCTIK GLRDRRIRLS IPTAIQLYDL 60 QNKLGLSQPS KVIDWLIDVT RFEIDKLPPL PFPKDFDPNA SILHHSDIGD AAFKAKNEET 120 DHTLL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zkt_A	9e-19	34	88	1	55	Putative transcription factor PCF6
5zkt_B	9e-19	34	88	1	55	Putative transcription factor PCF6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681932	1e-179	LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBank	LN713266	1e-179	LN713266.1 Cucumis melo genomic chromosome, chr_12.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011660343.1	1e-87	PREDICTED: transcription factor TCP5
Swissprot	Q9FME3	1e-38	TCP5_ARATH; Transcription factor TCP5
TrEMBL	A0A0A0LTI3	2e-86	A0A0A0LTI3_CUCSA; Uncharacterized protein
STRING	XP_004137441.1	4e-87	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF932	34	119

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60970.1	8e-34	TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5

Link Out ? help Back to Top
Phytozome	Cucsa.113300.1
Entrez Gene	101204687

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]