PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.118200.1

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

WRKY

Protein Properties

Length: 148aa MW: 16379.3 Da PI: 9.0615

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.118200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	108.4	3.4e-34	79	136	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYY+Cts++C+vkk+vers+edp++v++tYeg+Hnh Cucsa.118200.1 79 EDGYRWRKYGQKAVKNSPFPRSYYKCTSQNCSVKKRVERSSEDPSFVITTYEGKHNHY 136 8********************************************************5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.8E-35	65	136	IPR003657	WRKY domain
SuperFamily	SSF118290	1.11E-29	71	138	IPR003657	WRKY domain
PROSITE profile	PS50811	32.294	73	138	IPR003657	WRKY domain
SMART	SM00774	4.8E-39	78	137	IPR003657	WRKY domain
Pfam	PF03106	2.0E-27	79	135	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MSCSSSEVIC SVDDALKKSS SLGRDLSSVV TGEHPSTPNC SSTTCSSDEV VAGGGKKKEK 60 REKGPRFAFL TKTEIDNLED GYRWRKYGQK AVKNSPFPRS YYKCTSQNCS VKKRVERSSE 120 DPSFVITTYE GKHNHYCPIT LRGHNPTG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	8e-30	71	138	10	77	Probable WRKY transcription factor 4
2lex_A	8e-30	71	138	10	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681921	1e-65	LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBank	LN713265	1e-65	LN713265.1 Cucumis melo genomic chromosome, chr_11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011656990.1	3e-85	PREDICTED: probable WRKY transcription factor 12
Swissprot	Q8VWJ2	2e-41	WRK28_ARATH; WRKY transcription factor 28
Swissprot	Q93WV4	2e-41	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	A0A0A0KBC5	7e-84	A0A0A0KBC5_CUCSA; Uncharacterized protein
STRING	XP_008456349.1	4e-83	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF24673	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	9e-44	WRKY DNA-binding protein 71

Link Out ? help Back to Top
Phytozome	Cucsa.118200.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]