PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.128620.2

Common Name

Csa_7G413890

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 210aa MW: 24290.6 Da PI: 9.5051

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.128620.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57	4.4e-18	27	74	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd l ++v+ +G g+W+++ar+ g++Rt+k+c++rw++yl Cucsa.128620.2 27 KGPWTAEEDSVLFNYVNCHGEGRWNAVARCTGLKRTGKSCRLRWLNYL 74 79********************************************97 PP
2	Myb_DNA-binding	47.6	4e-15	80	123	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ Cucsa.128620.2 80 RGNITLQEQLLILELHFRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 123 7899****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.141	22	78	IPR017930	Myb domain
SuperFamily	SSF46689	2.43E-31	24	121	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-14	26	76	IPR001005	SANT/Myb domain
Pfam	PF00249	6.6E-16	27	74	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-22	28	81	IPR009057	Homeodomain-like
CDD	cd00167	5.69E-11	29	74	No hit	No description
PROSITE profile	PS51294	17.209	79	129	IPR017930	Myb domain
SMART	SM00717	3.4E-13	79	127	IPR001005	SANT/Myb domain
Pfam	PF00249	4.6E-14	80	123	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-21	82	128	IPR009057	Homeodomain-like
CDD	cd00167	8.81E-7	100	123	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 210 aa Download sequence Send to blast
MDVKMRGFRC GEPQKIKEEE EEMDVRKGPW TAEEDSVLFN YVNCHGEGRW NAVARCTGLK 60 RTGKSCRLRW LNYLRPSVRR GNITLQEQLL ILELHFRWGN RWSKIAQYLP GRTDNEIKNY 120 WRTRVQKQAK QLNCDVNSKQ FRDAMRYVWM PRLLERIQAS TDSTTTIVDV IQPPHPPLEL 180 TQSSPSGSSW VNPHVAPTTS SSDSISDQV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-25	24	129	4	108	B-MYB
1h8a_C	6e-25	24	129	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269\|PubMed:11310740}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269\|PubMed:11310740}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ036901	0.0	FJ036901.1 Cucumis sativus clone CU20C06 myb-like transcription factor Myb5 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004136147.2	1e-156	PREDICTED: transcription factor MYB108-like
Swissprot	Q2QZJ8	5e-81	JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBL	A0A0A0K5V3	1e-151	A0A0A0K5V3_CUCSA; Uncharacterized protein
TrEMBL	A0A1S3CEB9	1e-151	A0A1S3CEB9_CUCME; transcription factor MYB108-like
STRING	XP_008461407.1	1e-152	(Cucumis melo)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49620.1	4e-76	myb domain protein 78

Link Out ? help Back to Top
Phytozome	Cucsa.128620.2

Publications ? help Back to Top
Ahn IP,Kim S,Kang S,Suh SC,Lee YH Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct. Phytopathology, 2005. 95(11): p. 1248-55 [PMID:18943354] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Campos-Soriano L,García-Martínez J,San Segundo B The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection. Mol. Plant Pathol., 2012. 13(6): p. 579-92 [PMID:22212404] Yokotani N, et al. Role of the rice transcription factor JAmyb in abiotic stress response. J. Plant Res., 2013. 126(1): p. 131-9 [PMID:22847900] Wang D, et al. Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response. Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007 [PMID:26740780] Fred AK,Kiswara G,Yi G,Kim KM Screening Rice Cultivars for Resistance to Bacterial Leaf Blight. J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45 [PMID:26869604]