PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.139620.1

Common Name

Csa_6G177190

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MIKC_MADS

Protein Properties

Length: 237aa MW: 27155.6 Da PI: 9.5886

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.139620.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.6	2.5e-31	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Cucsa.139620.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 58 79***********************************************8 PP
2	K-box	105.6	5.8e-35	78	174	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +sg s++ea+ + +qqe++kLk++i+++q+++Rh+lGe L+sL lkeL++Le +Le++++k+R+kKne l++++e +qk+e elq++n++Lr+++ Cucsa.139620.1 78 NSGLSVAEANVQFYQQEATKLKRQIREIQNSNRHILGEALSSLPLKELKSLEGRLERGISKVRAKKNETLFAEMEFMQKREMELQSHNNYLRAQI 172 566669****************************************************************************************9 PP K-box 99 ee 100 +e Cucsa.139620.1 173 AE 174 86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.964	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.4E-42	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.13E-44	2	78	No hit	No description
SuperFamily	SSF55455	1.44E-32	2	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.5E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.5E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.5E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.2E-25	87	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.606	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 237 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYANN 60 SVRGTIERYK KAFADSSNSG LSVAEANVQF YQQEATKLKR QIREIQNSNR HILGEALSSL 120 PLKELKSLEG RLERGISKVR AKKNETLFAE MEFMQKREME LQSHNNYLRA QIAEHERIQQ 180 QQQQQQQTNM MQRATYESVG GQYDDENRST YGAVGALMDS DSHYAPQDHL TALQLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
5f28_A	1e-20	1	69	1	69	MEF2C
5f28_B	1e-20	1	69	1	69	MEF2C
5f28_C	1e-20	1	69	1	69	MEF2C
5f28_D	1e-20	1	69	1	69	MEF2C
6byy_A	1e-20	1	69	1	69	MEF2 CHIMERA
6byy_B	1e-20	1	69	1	69	MEF2 CHIMERA
6byy_C	1e-20	1	69	1	69	MEF2 CHIMERA
6byy_D	1e-20	1	69	1	69	MEF2 CHIMERA
6bz1_A	2e-20	1	69	1	69	MEF2 CHIMERA
6bz1_B	2e-20	1	69	1	69	MEF2 CHIMERA
6c9l_A	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00093	SELEX	Transfer from AT3G58780	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ312773	0.0	AJ312773.1 Cucumis sativus mRNA for MADS1 protein (m1 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001292697.1	1e-175	floral homeotic protein AGAMOUS
Swissprot	Q93XH4	1e-112	MADS1_VITVI; Agamous-like MADS-box protein MADS1
TrEMBL	A0A0A0KC22	1e-172	A0A0A0KC22_CUCSA; Uncharacterized protein
TrEMBL	Q9ARE9	1e-174	Q9ARE9_CUCSA; MADS1 protein
STRING	XP_008456449.1	1e-124	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF684	29	102

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.1	3e-94	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Cucsa.139620.1

Publications ? help Back to Top
Boss PK,Vivier M,Matsumoto S,Dry IB,Thomas MR A cDNA from grapevine (Vitis vinifera L.), which shows homology to AGAMOUS and SHATTERPROOF, is not only expressed in flowers but also throughout berry development. Plant Mol. Biol., 2001. 45(5): p. 541-53 [PMID:11414613] Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]