PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.158330.1
Common NameCsa_5G636500, LOC101213061
Organism
Cucumis sativus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 68aa    MW: 7027.76 Da    PI: 7.2713
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.158330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.3e-32257359
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    +vrY eC+kNhAa +Gg+avDGC+Efm+s g+egt+a+l+CaACgCHRnFHRr+v +
  Cucsa.158330.1  2 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GDEGTTAGLTCAACGCHRNFHRRQVGT 57
                    69**************************9.999********************9865 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-27167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.6E-30354IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.0E-27454IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.573554IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
RSVRYGECQK NHAAGVGGYA VDGCREFMAS GDEGTTAGLT CAACGCHRNF HRRQVGTEVV  60
CDCSSSP*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818896e-90LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132636e-90LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148693.13e-43PREDICTED: mini zinc finger protein 2
RefseqXP_016902406.14e-43PREDICTED: mini zinc finger protein 2
SwissprotQ9LJW51e-35MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0A0KVJ78e-42A0A0A0KVJ7_CUCSA; Transcription factor
TrEMBLA0A1S4E2E91e-41A0A1S4E2E9_CUCME; mini zinc finger protein 2
STRINGXP_008459312.12e-42(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.16e-38mini zinc finger 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]