PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.174530.1
Organism
Cucumis sativus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 89aa    MW: 10196.7 Da    PI: 10.0084
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.174530.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.7e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtfskRr+g+lKKA+E+SvLC+a+va+i+fs++gkl+eyss
  Cucsa.174530.1  9 KRIENKISRQVTFSKRRAGLLKKAHEISVLCEADVALIVFSTKGKLFEYSS 59
                    79***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-33280IPR002100Transcription factor, MADS-box
CDDcd002654.06E-40276No hitNo description
PRINTSPR004041.6E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGRGRVQLKR IENKISRQVT FSKRRAGLLK KAHEISVLCE ADVALIVFST KGKLFEYSSD  60
SSMEKILEKY ERYSYAERPL APNGDSELQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-23174173MEF2 CHIMERA
6byy_B2e-23174173MEF2 CHIMERA
6byy_C2e-23174173MEF2 CHIMERA
6byy_D2e-23174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}.
UniProtTranscription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}.
UniProtTranscription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818686e-94LN681868.1 Cucumis melo genomic scaffold, anchoredscaffold00090.
GenBankLN7132616e-94LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137262.18e-58PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1
RefseqXP_011653412.17e-58PREDICTED: truncated transcription factor CAULIFLOWER D isoform X2
SwissprotB4YPW69e-47AP1A_BRAOA; Floral homeotic protein APETALA 1 A
SwissprotQ8GTF59e-47AP1A_BRAOB; Floral homeotic protein APETALA 1 A
SwissprotQ963569e-472AP1_BRAOT; Floral homeotic protein APETALA 1-2
TrEMBLA0A1S3CMB88e-56A0A1S3CMB8_CUCME; truncated transcription factor CAULIFLOWER D
STRINGXP_004137262.13e-57(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-48MIKC_MADS family protein