PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.174700.1

Common Name

Csa_4G122810, LOC101210660

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

bZIP

Protein Properties

Length: 147aa MW: 17248 Da PI: 6.7997

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.174700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.9	3e-15	78	134	5	61
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +++rr+++NRe+ArrsR RK++ ++eL v L +eN++L+++l++ ++ ++ + Cucsa.174700.1 78 RKQRRMISNRESARRSRMRKQKHLDELWSQVLWLRNENHQLIDRLNQVSECHDRALQ 134 689******************************************999886665555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.5E-14	74	138	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.45	76	127	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	5.8E-11	78	146	No hit	No description
Pfam	PF00170	4.4E-13	78	130	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.06E-13	78	127	No hit	No description
CDD	cd14702	7.04E-18	79	130	No hit	No description
PROSITE pattern	PS00036	0	81	96	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MQPGEIASLH YLLSSNPSLY TSQFIMSHDS TNMMHLNQFS NPLSKFKYPS QDMNPPSLSS 60 NSTSDEAEDQ QLSLINERKQ RRMISNRESA RRSRMRKQKH LDELWSQVLW LRNENHQLID 120 RLNQVSECHD RALQENAQLK EEASELX

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	90	97	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681870	0.0	LN681870.1 Cucumis melo genomic scaffold, anchoredscaffold00035.
GenBank	LN713261	0.0	LN713261.1 Cucumis melo genomic chromosome, chr_7.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004137148.1	1e-102	PREDICTED: basic leucine zipper 43-like
Swissprot	Q9FMC2	1e-36	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	A0A0A0KZE6	1e-101	A0A0A0KZE6_CUCSA; Uncharacterized protein
STRING	XP_004137148.1	1e-102	(Cucumis sativus)
STRING	XP_004154731.1	1e-102	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1604	33	99

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30530.1	3e-47	basic leucine-zipper 42

Link Out ? help Back to Top
Phytozome	Cucsa.174700.1
Entrez Gene	101210660

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]