![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.182040.1 | ||||||||
| Common Name | Csa_1G569530, LOC101208858 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 91aa MW: 10507.7 Da PI: 5.176 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 24.2 | 7e-08 | 5 | 72 | 16 | 82 |
NF-YC 16 fknhelPlarikkilka.dedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaa 82
+ +lP+a + +i+k+ ++ +is ea + + fi +t + ++++ +rrtl+ di a
Cucsa.182040.1 5 WESLQLPIANVERIMKKiVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNENRRTLNGDDIYWA 72
56779**********75379******************************************999876 PP
| |||||||
| 2 | NF-YB | 122.9 | 1.3e-38 | 9 | 89 | 7 | 87 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
lPianv rimkk++P+++kisk+ak+ +qec+ efi fvtsea+++cq+e+r+t+ngdd++wa+ +lG+++y+e+ ++yl
Cucsa.182040.1 9 QLPIANVERIMKKIVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNENRRTLNGDDIYWAFDSLGLDNYAEASSKYL 89
69**************************************************************************99998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-36 | 4 | 89 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.71E-29 | 7 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.3E-25 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-10 | 37 | 55 | No hit | No description |
| PRINTS | PR00615 | 1.7E-10 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 1.7E-10 | 75 | 91 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MGENWESLQL PIANVERIMK KIVPEKGKIS KEAKKRMQEC ANEFINFVTS EAAQRCQNEN 60 RRTLNGDDIY WAFDSLGLDN YAEASSKYLL X |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-31 | 10 | 89 | 8 | 87 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-31 | 10 | 89 | 8 | 87 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681806 | 1e-109 | LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025. | |||
| GenBank | LN713256 | 1e-109 | LN713256.1 Cucumis melo genomic chromosome, chr_2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004135781.1 | 6e-62 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 7e-35 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A0A0LZ17 | 1e-60 | A0A0A0LZ17_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004135781.1 | 2e-61 | (Cucumis sativus) | ||||
| STRING | XP_004157295.1 | 2e-61 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 3e-37 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.182040.1 |
| Entrez Gene | 101208858 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




