PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.298560.1

Common Name

Csa_4G000530, LOC101221957

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

M-type_MADS

Protein Properties

Length: 226aa MW: 25575.1 Da PI: 10.0312

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.298560.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	69.4	3.2e-22	17	61	5	49
SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KKA+EL++LC+ae+a+i+fs+ k++ + Cucsa.298560.1 17 NESNLQVTFSKRRSGLFKKASELCTLCGAEIAIIVFSPGKKVFSF 61 89************************************9999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.7E-30	5	64	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	23.549	5	65	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.12E-33	6	73	No hit	No description
SuperFamily	SSF55455	1.44E-25	6	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-18	7	27	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.7E-24	16	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-18	27	42	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-18	42	63	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009960	Biological Process	endosperm development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 226 aa Download sequence Send to blast
MRKSRGRQKV EMVKMPNESN LQVTFSKRRS GLFKKASELC TLCGAEIAII VFSPGKKVFS 60 FGHPCVEALI ERFVTRNPPP SSGTLQLIEA HRNANVRELN AQLTQVLNQL EMERKRGEEL 120 NKLRKASQAQ CWWELPIEEM EMHQLEQLKA SLDELKKNVT QQADRILIQT SSNANPPTQL 180 IFPTQIPTQT STTTNGPNQQ PGLFVVDPKN IISHLPFNYG SYGSRX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_B	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_I	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3kov_J	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_A	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_B	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_C	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_D	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_I	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
3p57_J	7e-16	6	84	1	79	Myocyte-specific enhancer factor 2A
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681874	0.0	LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBank	LN713261	0.0	LN713261.1 Cucumis melo genomic chromosome, chr_7.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004150272.1	1e-167	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	3e-68	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A0A0KWA9	1e-165	A0A0A0KWA9_CUCSA; Uncharacterized protein
STRING	XP_004156875.1	1e-166	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF128	33	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	2e-70	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	Cucsa.298560.1
Entrez Gene	101221957

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]