![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.307040.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 86aa MW: 9433.52 Da PI: 10.9642 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 133.4 | 5.8e-42 | 19 | 85 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ +eakG+nP livll+vgglll+flvgny+ly yaqknlPP+kkkPvskkk+kre+lkqGv++PGe
Cucsa.307040.1 19 NDIEAKGFNPALIVLLLVGGLLLIFLVGNYALYLYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 85
789***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 2.0E-4 | 18 | 85 | No hit | No description |
| Pfam | PF04689 | 2.2E-39 | 21 | 85 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MGNFKLLGWK LVIKGNVIND IEAKGFNPAL IVLLLVGGLL LIFLVGNYAL YLYAQKNLPP 60 KKKKPVSKKK MKRERLKQGV SAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681841 | 1e-109 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
| GenBank | LN713258 | 1e-109 | LN713258.1 Cucumis melo genomic chromosome, chr_4. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004137812.1 | 7e-43 | PREDICTED: DNA-binding protein S1FA-like | ||||
| Swissprot | Q42337 | 2e-14 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A0A0LAW3 | 2e-41 | A0A0A0LAW3_CUCSA; DNA-binding protein S1FA | ||||
| STRING | XP_004165146.1 | 3e-42 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.307040.1 |




