![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.321060.2 | ||||||||
| Common Name | Csa_3G019390, LOC101211526 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 244aa MW: 26544.5 Da PI: 6.0893 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 41.5 | 3.1e-13 | 7 | 51 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ ++ + ++lG+g+W+ Iar Rt+ q+ s+ qky
Cucsa.321060.2 7 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 51
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.324 | 1 | 56 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.01E-16 | 3 | 57 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.0E-10 | 4 | 54 | IPR001005 | SANT/Myb domain |
| TIGRFAMs | TIGR01557 | 2.6E-19 | 5 | 55 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-11 | 6 | 50 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 6.4E-11 | 7 | 51 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.25E-10 | 7 | 52 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0030307 | Biological Process | positive regulation of cell growth | ||||
| GO:0046686 | Biological Process | response to cadmium ion | ||||
| GO:0048366 | Biological Process | leaf development | ||||
| GO:2000469 | Biological Process | negative regulation of peroxidase activity | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000976 | Molecular Function | transcription regulatory region sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 244 aa Download sequence Send to blast |
MEKIGVPWTE EEHRMFLLGL QKLGKGDWRG IARNYVVSRT PTQVASHAQK YFIRQTNVSR 60 RKRRSSLFDI VADERVENSI VQQDFLSANS SHAESQSNNP LPTPPTTVDE ECESMDSTNS 120 NDGETAPAEP DGPQCCYPVV YPAYVAPFFP FSIPFYSGYS AETTNKETHE VLKPTAVHSK 180 SPLNVDELIG MSKLSLGESI GHSGPSSLSL KLLEGSSRRS AFHANPASGS ENMSSGGSPI 240 HAV* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00551 | DAP | Transfer from AT5G47390 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681860 | 0.0 | LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021. | |||
| GenBank | LN713260 | 0.0 | LN713260.1 Cucumis melo genomic chromosome, chr_6. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011650388.1 | 1e-178 | PREDICTED: transcription factor MYB1R1 | ||||
| Swissprot | Q7XC57 | 1e-80 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| Swissprot | Q9LVS0 | 2e-80 | KUA1_ARATH; Transcription factor KUA1 | ||||
| TrEMBL | A0A0A0L263 | 1e-176 | A0A0A0L263_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004147257.1 | 1e-177 | (Cucumis sativus) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47390.1 | 3e-76 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.321060.2 |
| Entrez Gene | 101211526 |




