![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.341290.1 | ||||||||
| Common Name | Csa_3G849890 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 118aa MW: 13205.6 Da PI: 10.3083 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 130.3 | 5.2e-41 | 16 | 75 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+
Cucsa.341290.1 16 EQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKNSKR 75
5789****************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-30 | 11 | 75 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 4.4E-34 | 18 | 74 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.571 | 20 | 74 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 22 | 58 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010200 | Biological Process | response to chitin | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MQDPSTFQPI KPQFPEQEQL KCPRCDSTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGAL 60 RNIPVGGGTR KNSKRAVAAT VKRPPSSTSS THPNTITVPD HNPIRGYGGG LDIPGSFX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00199 | DAP | Transfer from AT1G51700 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681827 | 1e-174 | LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018. | |||
| GenBank | LN713258 | 1e-174 | LN713258.1 Cucumis melo genomic chromosome, chr_4. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008447593.1 | 1e-76 | PREDICTED: dof zinc finger protein DOF1.7-like | ||||
| Swissprot | O82155 | 5e-41 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
| TrEMBL | A0A0A0LDG2 | 2e-82 | A0A0A0LDG2_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004146854.1 | 4e-83 | (Cucumis sativus) | ||||
| STRING | XP_004154872.1 | 4e-83 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6181 | 33 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G51700.1 | 7e-43 | DOF zinc finger protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.341290.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




