![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cucsa.341850.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 66aa MW: 7358.88 Da PI: 8.5032 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 35.7 | 2.5e-11 | 20 | 62 | 5 | 47 |
DUF260 5 CkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
k+l +C+++C+l pyfp ++p kf ++h +F +sn++kll
Cucsa.341850.1 20 WKILHWRCTEKCILMPYFPPSEPLKFTIAHCIFDTSNIIKLLL 62
588999**********************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 10.807 | 15 | 65 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 7.0E-11 | 19 | 62 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
VVTSPSLLQA SVVVSSYVAW KILHWRCTEK CILMPYFPPS EPLKFTIAHC IFDTSNIIKL 60 LLVLP* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008463550.1 | 6e-20 | PREDICTED: LOB domain-containing protein 1-like | ||||
| Swissprot | Q9LQR0 | 1e-16 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
| TrEMBL | A0A1S3CK12 | 1e-18 | A0A1S3CK12_CUCME; LOB domain-containing protein 1-like | ||||
| STRING | XP_008463550.1 | 2e-19 | (Cucumis melo) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07900.1 | 6e-19 | LOB domain-containing protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cucsa.341850.1 |




