PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.352560.1

Common Name

Csa_4G641690, LOC101218543

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 197aa MW: 21672.9 Da PI: 8.512

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.352560.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.4	9e-20	9	54	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W+++Edell ++v+ +G+++W++I++ ++ gR++k+c++rw + Cucsa.352560.1 9 KGPWSPDEDELLRRLVHNYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 54 79****************************.*********985 PP
2	Myb_DNA-binding	53.8	4.6e-17	63	105	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T +Ed+ +++a+ ++G++ W+tIar ++ gRt++ +k++w++ Cucsa.352560.1 63 PFTSDEDDTIIQAHSRFGNK-WATIARLLN-GRTDNAIKNHWNST 105 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.287	4	59	IPR017930	Myb domain
SuperFamily	SSF46689	5.99E-32	6	102	IPR009057	Homeodomain-like
SMART	SM00717	3.9E-17	8	57	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-19	9	54	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.5E-26	10	62	IPR009057	Homeodomain-like
CDD	cd00167	3.90E-17	11	53	No hit	No description
SMART	SM00717	1.3E-13	60	108	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.968	61	110	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-22	63	109	IPR009057	Homeodomain-like
Pfam	PF00249	1.9E-14	63	105	IPR001005	SANT/Myb domain
CDD	cd00167	1.42E-11	63	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 197 aa Download sequence Send to blast
MATITDRIKG PWSPDEDELL RRLVHNYGPR NWSLISKSIP GRSGKSCRLR WCNQLSPEVE 60 HRPFTSDEDD TIIQAHSRFG NKWATIARLL NGRTDNAIKN HWNSTLKRKS SSSAPEDDHP 120 LKRSTSASAP PLYFNPSSPS GSDLSDSSLS GMSSSQVCKP FPPVPPLISH SNHPPMDTTS 180 IDPPTSLTLS LPGSDSX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	5e-42	8	109	3	104	C-Myb DNA-Binding Domain
1msf_C	5e-42	8	109	3	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681861	0.0	LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBank	LN713261	0.0	LN713261.1 Cucumis melo genomic chromosome, chr_7.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004141275.1	1e-141	PREDICTED: transcription factor MYB44-like
Swissprot	Q9FDW1	6e-77	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0A0L3P9	1e-139	A0A0A0L3P9_CUCSA; Uncharacterized protein
STRING	XP_004141275.1	1e-140	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF843	34	124

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50060.1	2e-71	myb domain protein 77

Link Out ? help Back to Top
Phytozome	Cucsa.352560.1
Entrez Gene	101218543

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]